USP49 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18117325UL

Catalog No. NB433926

Description

USP49 Polyclonal specifically detects USP49 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: USP49
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q70CQ1
• Gene Symbols: USP49
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GQKQDTPVRRGRTLRSMASGEDVVLPQRAPQGQPQMLTALWYRRQRLLARTLRLWFEKSSRGQAKLEQRRQEEALERK
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Deubiquitinating enzyme 49, EC 3.1.2.15, EC 3.4.19.12, MGC20741, ubiquitin carboxyl-terminal hydrolase 49, ubiquitin specific peptidase 49, ubiquitin specific protease 49, ubiquitin thioesterase 49, Ubiquitin thiolesterase 49, Ubiquitin-specific-processing protease 49
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 25862
• Target Species: Human
• Isotype: IgG

For Research Use Only