Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MSANTD3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
| Antigen | MSANTD3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1984420
|
Novus Biologicals
NBP19844120UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP198441
|
Novus Biologicals
NBP198441 |
100 μL |
Each for $499.50
|
|
|||||
Description
MSANTD3 Polyclonal specifically detects MSANTD3 in Human samples. It is validated for Western Blot.Specifications
| MSANTD3 | |
| Polyclonal | |
| Rabbit | |
| NP_542386 | |
| 91283 | |
| The immunogen for this antibody is C9orf30 - C-terminal region. Peptide sequence VRITANKNYRSKTSQEGALKKMHEEEHHQQMSILQLQLIQMNEVHVAKIQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C9orf30, chromosome 9 open reading frame 30, FLJ34973, hypothetical protein LOC91283, L8, MGC17337, MSANTD3, Myb/SANT-like DNA-binding domain containing 3 | |
| MSANTD3 | |
| IgG | |
| 30 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title