APJ/Apelin receptor Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198465

Catalog No. NBP198465

Description

APJ/Apelin receptor Polyclonal specifically detects APJ/Apelin receptor in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: APJ/Apelin receptor
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AGTRL1HG11, angiotensin II receptor-like 1, Angiotensin receptor-like 1, apelin receptor, APJ (apelin) receptor, APJ receptor, APJFLJ96609, APJR, FLJ90771, G protein-coupled receptor APJ, G-protein coupled receptor APJ, G-protein coupled receptor HG11, HG11 orphan receptor, MGC45246
• Host Species: Rabbit
• Molecular Weight of Antigen: 42 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 86%; Rat: 86%.
• Target Species: Human, Mouse, Rat, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_035914
• Gene Symbols: APLNR
• Immunogen: The immunogen for this antibody is apelin receptor - C-terminal region. Peptide sequence CCDQSGCKGTPHSSSAEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 187
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.