Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNAJC19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | DNAJC19 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DNAJC19 Polyclonal specifically detects DNAJC19 in Mouse samples. It is validated for Western Blot.Specifications
DNAJC19 | |
Polyclonal | |
Rabbit | |
NP_080608 | |
131118 | |
The immunogen for this antibody is Dnajc19 - N-terminal region. Peptide sequence QVFQSLPKSAFGGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRR. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DnaJ (Hsp40) homolog, subfamily C, member 19, DnaJ homolog subfamily C member 19, homolog of yeast TIM14, mitochondrial import inner membrane translocase subunit TIM14, Tim14, TIMM14TIM14Pam18 | |
DNAJC19 | |
IgG | |
116 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title