USAG1/SOSTDC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198525

Catalog No. NBP198525

Description

USAG1/SOSTDC1 Polyclonal specifically detects USAG1/SOSTDC1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: USAG1/SOSTDC1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: cystine-knot containing secreted protein, DKFZp564D206, Ectodermal BMP inhibitor, ECTODIN, sclerostin domain containing 1, sclerostin domain-containing protein 1, USAG-1, USAG1uterine sensitization-associated protein-1, Uterine sensitization-associated gene 1 protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 21 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 25928
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_056279
• Gene Symbols: SOSTDC1
• Immunogen: The immunogen for this antibody is SOSTDC1 - C-terminal region. Peptide sequence ITVVTACKCKRYTRQHNESSHNFESMSPAKPVQHHRERKRASKSSKHSMS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Bovine: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG