HspA1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198547

Catalog No. NBP198547

Description

HspA1B Polyclonal specifically detects HspA1B in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

• Antigen: HspA1B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ54328, Heat shock 70 kDa protein 1/2, heat shock 70 kDa protein 1A/1B, heat shock 70kD protein 1B, heat shock 70kDa protein 1B, HSP70.1/HSP70.2, HSP70-1/HSP70-2, HSP70-1B, HSP70-2, HSPA1, HSPA1A
• Host Species: Rabbit
• Molecular Weight of Antigen: 70 kDa
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 3304
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry
• Gene Accession No.: NP_005337
• Gene Symbols: HSPA1B
• Immunogen: The immunogen for this antibody is HSPA1B - C-terminal region. Peptide sequence DKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Mouse: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Sheep, Zebrafish
• Isotype: IgG