Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. HspA1B Antibody, Novus Biologicals™

HspA1B Antibody, Novus Biologicals™
SDP

Catalog No. NBP19854720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19854720 20 μL
NBP198547 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19854720 Supplier Novus Biologicals Supplier No. NBP19854720UL

Description

Rabbit Polyclonal Antibody

HspA1B Polyclonal specifically detects HspA1B in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

Antigen HspA1B
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000, Immunohistochemistry
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_005337
Gene Alias FLJ54328, Heat shock 70 kDa protein 1/2, heat shock 70 kDa protein 1A/1B, heat shock 70kD protein 1B, heat shock 70kDa protein 1B, HSP70.1/HSP70.2, HSP70-1/HSP70-2, HSP70-1B, HSP70-2, HSPA1, HSPA1A
Gene Symbols HSPA1B
Host Species Rabbit
Immunogen The immunogen for this antibody is HSPA1B - C-terminal region. Peptide sequence DKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNA.
Molecular Weight of Antigen 70 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 3304
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.