Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HspA1B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$208.00 - $487.50
Specifications
| Antigen | HspA1B |
|---|---|
| Applications | Western Blot, Immunohistochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19854720
|
Novus Biologicals
NBP19854720UL |
20 μL |
Each for $208.00
|
|
|||||
|
NBP198547
|
Novus Biologicals
NBP198547 |
100 μL |
Each for $487.50
|
|
|||||
Description
HspA1B Polyclonal specifically detects HspA1B in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
| HspA1B | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| FLJ54328, Heat shock 70 kDa protein 1/2, heat shock 70 kDa protein 1A/1B, heat shock 70kD protein 1B, heat shock 70kDa protein 1B, HSP70.1/HSP70.2, HSP70-1/HSP70-2, HSP70-1B, HSP70-2, HSPA1, HSPA1A | |
| HSPA1B | |
| IgG | |
| 70 kDa |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| RUO | |
| NP_005337 | |
| 3304 | |
| The immunogen for this antibody is HSPA1B - C-terminal region. Peptide sequence DKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title