Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NT2NL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP198582
Description
NT2NL Polyclonal specifically detects NT2NL in Human samples. It is validated for Western Blot.Specifications
NT2NL | |
Polyclonal | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ35032, FLJ55807, N2NNotch homolog 2 (Drosophila) N-terminal like, notch 2 N-terminal like, Notch homolog 2 N-terminal like protein, notch homolog 2 N-terminal-like protein | |
Rabbit | |
26 kDa | |
100 μL | |
Growth and Development, Neuronal Cell Markers | |
388677 | |
Human | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_982283 | |
NOTCH2NL | |
The immunogen for this antibody is NT2NL - C-terminal region. Peptide sequence LYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGK. | |
Affinity purified | |
RUO | |
Primary | |
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution. | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction