Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NT2NL Antibody, Novus Biologicals™
SDP

Catalog No. NBP198582 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP198582 100 μL
NBP19858220 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP198582 Supplier Novus Biologicals Supplier No. NBP198582
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

NT2NL Polyclonal specifically detects NT2NL in Human samples. It is validated for Western Blot.

Specifications

Antigen NT2NL
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_982283
Gene Alias FLJ35032, FLJ55807, N2NNotch homolog 2 (Drosophila) N-terminal like, notch 2 N-terminal like, Notch homolog 2 N-terminal like protein, notch homolog 2 N-terminal-like protein
Gene Symbols NOTCH2NL
Host Species Rabbit
Immunogen The immunogen for this antibody is NT2NL - C-terminal region. Peptide sequence LYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGK.
Molecular Weight of Antigen 26 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Growth and Development, Neuronal Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 388677
Reconstitution Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.