GNA11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198606

Catalog No. NBP198606

Description

GNA11 Polyclonal specifically detects GNA11 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: GNA11
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: G alpha-11, GA11, GNA-11, G-protein subunit alpha-11, guanine nucleotide binding protein (G protein), alpha 11 (Gq class), Guanine nucleotide-binding protein G(y) subunit alpha, guanine nucleotide-binding protein subunit alpha-11, guanine nucleotide-binding protein, Gq class, GNA11
• Host Species: Rabbit
• Molecular Weight of Antigen: 41 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_002058
• Gene Symbols: GNA11
• Immunogen: The immunogen for this antibody is GNA11 - C-terminal region. Peptide sequence PFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVES.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2767
• Target Species: Human, Mouse, Rat, Amphibian, Canine, Equine, Guinea Pig, Goat, Rabbit, Sheep, Zebrafish
• Isotype: IgG