Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

V alpha 24 J alpha 18 TCR Antibody (6B11) - BSA Free, Novus Biologicals™
SDP

Catalog No. NBP198260 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP198260 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP198260 Supplier Novus Biologicals Supplier No. NBP198260

Rabbit Polyclonal Antibody

NT5C3L Polyclonal specifically detects NT5C3L in Rat samples. It is validated for Western Blot.

Specifications

Antigen NT5C3L
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. XP_002724687
Gene Alias 5'-nucleotidase, cytosolic III-like
Gene Symbols NT5C3B
Host Species Rabbit
Immunogen The immunogen for this antibody is LOC100364937 - C-terminal region. Peptide sequence FKGQLIHTYNKNSSVCENSSYFQQLRNKTNIILLGDSIGDLTMADGVPGV.
Molecular Weight of Antigen 29 kDa
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 115024
Test Specificity Pig: 86%, Zebrafish: 82%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit, Zebrafish
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.