V alpha 24 J alpha 18 TCR Antibody (6B11) - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198260

Catalog No. NBP198260

Description

NT5C3L Polyclonal specifically detects NT5C3L in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: NT5C3L
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: XP_002724687
• Gene Symbols: NT5C3B
• Immunogen: The immunogen for this antibody is LOC100364937 - C-terminal region. Peptide sequence FKGQLIHTYNKNSSVCENSSYFQQLRNKTNIILLGDSIGDLTMADGVPGV.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Pig: 86%, Zebrafish: 82%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 5'-nucleotidase, cytosolic III-like
• Host Species: Rabbit
• Molecular Weight of Antigen: 29 kDa
• Quantity: 100 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 115024
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.