Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
VMA21 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | VMA21 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15991820
|
Novus Biologicals
NBP15991820UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP159918
|
Novus Biologicals
NBP159918 |
100 μL |
Each for $487.50
|
|
|||||
Description
VMA21 Polyclonal specifically detects VMA21 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| VMA21 | |
| Polyclonal | |
| Purified | |
| RUO | |
| MEAXMGC131652, MGC125514, myopathy with excessive autophagy, Myopathy with excessive autophagy protein, vacuolar ATPase assembly integral membrane protein VMA21, VMA21 vacuolar H+-ATPase homolog (S. cerevisiae), XMEAMGC125516 | |
| VMA21 | |
| IgG | |
| Protein A purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Q3ZAQ7 | |
| 203547 | |
| Synthetic peptides corresponding to LOC203547(hypothetical protein LOC203547) The peptide sequence was selected from the N terminal of LOC203547. Peptide sequence MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKS. | |
| Primary | |
| 11 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title