Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
VPS37C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | VPS37C |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156409
|
Novus Biologicals
NBP156409 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP15640920
|
Novus Biologicals
NBP15640920UL |
20 μL | N/A | N/A | N/A | ||||
Description
VPS37C Polyclonal specifically detects VPS37C in Human samples. It is validated for Western Blot.Specifications
| VPS37C | |
| Polyclonal | |
| Rabbit | |
| A5D8V6 | |
| 55048 | |
| Synthetic peptides corresponding to VPS37C(vacuolar protein sorting 37 homolog C (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS37C. Peptide sequence LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ESCRT-I complex subunit VPS37C, FLJ20847, hVps37C, PML39, vacuolar protein sorting 37 homolog C (S. cerevisiae), vacuolar protein sorting 37C, vacuolar protein sorting 37C (yeast), vacuolar protein sorting-associated protein 37C | |
| VPS37C | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title