Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
VSIG3/IGSF11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | VSIG3/IGSF11 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15950320
|
Novus Biologicals
NBP15950320UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159503
|
Novus Biologicals
NBP159503 |
100 μL |
Each for $487.50
|
|
|||||
Description
VSIG3/IGSF11 Polyclonal specifically detects VSIG3/IGSF11 in Human samples. It is validated for Western Blot.Specifications
| VSIG3/IGSF11 | |
| Polyclonal | |
| Rabbit | |
| Q5DX21 | |
| 152404 | |
| Synthetic peptides corresponding to IGSF11(immunoglobulin superfamily, member 11) The peptide sequence was selected from the middle region of IGSF11. Peptide sequence EKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Brain and testis-specific immunoglobulin superfamily protein, Bt-IGSF, BTIGSF, cancer/testis antigen 119, CT119, CXADR like 1, CXADRL1, IgSF11, Igsf13, immunoglobulin superfamily member 11, immunoglobulin superfamily, member 11, MGC35227, V-set and immunoglobulin domain containing 3, V-set and immunoglobulin domain-containing protein 3, VSIG3brain and testis-specific immunoglobin superfamily protein | |
| IGSF11 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title