Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WBP11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP154648
Description
WBP11 Polyclonal specifically detects WBP11 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.Specifications
WBP11 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DKFZp779M1063, Npw38-binding protein, Npw38-binding protein NpwBP, NpwBP, NPWBPsplicing factor, PQBP1 and PP1 interacting, SH3 domain-binding protein SNP70, SIPP1WW domain-binding protein 11, SNP70, Splicing factor that interacts with PQBP-1 and PP1, WBP-11, WW domain binding protein 11 | |
Rabbit | |
70 kDa | |
100 μL | |
Core ESC Like Genes, Stem Cell Markers | |
51729 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), Immunoprecipitation, Immunohistochemistry (Paraffin) | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin | |
Q9Y2W2 | |
WBP11 | |
Synthetic peptides corresponding to WBP11(WW domain binding protein 11) The peptide sequence was selected from the N terminal of WBP11. Peptide sequence GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK. | |
Affinity purified | |
RUO | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction