WNK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB437061	Novus Biologicals NBP23243425UL	25 μL
NBP232434	Novus Biologicals NBP232434	0.1 mL

Description

WNK1 Polyclonal specifically detects WNK1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: WNK1
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: EC 2.7.11, EC 2.7.11.1, Erythrocyte 65 kDa protein, HSAN2hereditary sensory neuropathy, type II, HSN2MGC163339, hWNK1, KDPMGC163341, KIAA0344, Kinase deficient protein, p65, PHA2C, PRKWNK1PSK, prostate-derived sterile 20-like kinase, Protein kinase lysine-deficient 1, Protein kinase with no lysine 1, protein kinase, lysine deficient 1, serine/threonine-protein kinase WNK1, WNK lysine deficient protein kinase 1
• Gene Symbols: WNK1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Protein Kinase, Signal Transduction, Transcription Factors and Regulators
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 65125
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PPFPAPSLTQSQQPLEDLDAQLRRTLSPEMITVTSAVGPVSMAAPTAITEAGTQPQKGVSQVKEGPVLATSSGAGVFKMGRFQVSVAADGA
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only