Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. WNK1 Antibody, Novus Biologicals™

WNK1 Antibody, Novus Biologicals™
SDP

Catalog No. p-200039261 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB437061 25 μL
NBP232434 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB437061 Supplier Novus Biologicals Supplier No. NBP23243425UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

WNK1 Polyclonal specifically detects WNK1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen WNK1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias EC 2.7.11, EC 2.7.11.1, Erythrocyte 65 kDa protein, HSAN2hereditary sensory neuropathy, type II, HSN2MGC163339, hWNK1, KDPMGC163341, KIAA0344, Kinase deficient protein, p65, PHA2C, PRKWNK1PSK, prostate-derived sterile 20-like kinase, Protein kinase lysine-deficient 1, Protein kinase with no lysine 1, protein kinase, lysine deficient 1, serine/threonine-protein kinase WNK1, WNK lysine deficient protein kinase 1
Gene Symbols WNK1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PPFPAPSLTQSQQPLEDLDAQLRRTLSPEMITVTSAVGPVSMAAPTAITEAGTQPQKGVSQVKEGPVLATSSGAGVFKMGRFQVSVAADGA
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Protein Kinase, Signal Transduction, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 65125
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.