Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Wnt3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Wnt3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156996
|
Novus Biologicals
NBP156996 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP15699620
|
Novus Biologicals
NBP15699620UL |
20 μL | N/A | N/A | N/A | ||||
Description
Wnt3 Polyclonal specifically detects Wnt3 in Human, Mouse samples. It is validated for Western Blot.Specifications
| Wnt3 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Signaling Pathway, Wnt Signaling Pathway | |
| INT4Proto-oncogene Int-4 homolog, MGC131950, MGC138321, MGC138323, proto-oncogene Wnt-3, wingless-type MMTV integration site family, member 3, WNT-3 proto-oncogene protein | |
| WNT3 | |
| IgG | |
| 43 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P56703 | |
| 7473 | |
| Synthetic peptides corresponding to WNT3 (wingless-type MMTV integration site family, member 3) The peptide sequence was selected from the middle region of WNT3 (NP_110380). Peptide sequence SHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title