Yes Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18536925UL

Catalog No. NB432311

Description

Yes Polyclonal specifically detects Yes in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Yes
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:20
• Gene Alias: cellular yes-1 protein, c-yes, EC 2.7.10, EC 2.7.10.2, HsT441, P61-YES, Proto-oncogene c-Yes, proto-oncogene tyrosine-protein kinase Yes, v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1, Yamaguchi sarcoma oncogene, Yes
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: YES1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLS
• Quantity: 25 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 7525
• Target Species: Human
• Isotype: IgG

For Research Use Only