Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZFP14 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | ZFP14 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17938820
|
Novus Biologicals
NBP17938820UL |
20 μL |
Each for $152.22
|
|
NBP179388
|
Novus Biologicals
NBP179388 |
100 μL |
Each for $436.00
|
|
Description
ZFP14 Polyclonal specifically detects ZFP14 in Human samples. It is validated for Western Blot.Specifications
| ZFP14 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| KIAA1559, zfp-14, zinc finger protein 14 homolog, zinc finger protein 14 homolog (mouse), zinc finger protein 531, ZNF531 | |
| ZFP14 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_065968 | |
| 57677 | |
| Synthetic peptide directed towards the N terminal of human ZFP14The immunogen for this antibody is ZFP14. Peptide sequence KSYSLQGSIFRNDWECKSKIEGEKEQQEGYFGQVKITSEKMTTYKRHNFL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title