Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ZNF177 Antibody, Novus Biologicals™

ZNF177 Antibody, Novus Biologicals™
SDP

Catalog No. NBP18029920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP18029920 20 μL
NBP180299 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP18029920 Supplier Novus Biologicals Supplier No. NBP18029920UL

Description

Rabbit Polyclonal Antibody

ZNF177 Polyclonal specifically detects ZNF177 in Human samples. It is validated for Western Blot.

Specifications

Antigen ZNF177
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. NP_003442
Gene Alias PIGX, zinc finger protein 177
Gene Symbols ZNF177
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human ZNF177. Peptide sequence MAAGWLTTWSQNSVTFQEVAVDFSQEEWALLDPAQKNLYKDVMLENFRNL.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7730
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.