accessibility menu, dialog, popup

UserName
Viewing profile as user:

Peptides

Short chains of amino acids linked by peptide (amide) bonds. Peptides are used as catalysts, signaling ligands, and imaging agents; for biometric hydrogel construction, immunoprecipitation processes, and more.
Gene ID (Entrez) 
  • (1)
  • (1)
  • (2)
Species 
  • (1)
  • (2)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (3)

brands

  • (1)
  • (1)
  • (1)
  • (4)
  • (1)
  • (3)
  • (1)

special interests

  • (8)

Gene ID (Entrez)

  • (1)
  • (1)
  • (2)

Species

  • (1)
  • (2)

Search Within Results
Keyword Search:
1 – 12 of 12 results
1

Novus Biologicals™ lactamase, beta 2 Recombinant Protein Antigen
SDP

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

5

eMolecules​ 39024-57-2 | Medchem Express | [Leu15]-Gastrin I (human) | 1mg | 785215554 | HY-P2671 | 2080.195 | C98H126N20O31

ChemScene | 6-Bromopyrrolo[21-f][124]triazin-4(3H)-one | 250mg | 711934755 | CS-0044409 | 888721-83-3 | MFCD27978785 | 214.022 | C6H4BrN3O

If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>

ENCOMPASS_PREFERRED
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
6

Bachem 3-Mercaptopropionyl-Tyr-Phe-Gln-Asn-Cys-Pro-D-Arg-Gly-NH2
SDP

(Deamino-Cys1,D-Arg8)-Vasopressin Acetate, 3-Mercaptopropionyl-Tyr-Phe-Gln-Asn-Cys-Pro-D-Arg-Gly-NH2, 16679-58-6, C46H64N14O12S2, Mr 1069.23, 1mg. Desmopressin, DDAVP, [Deamino1, DArg8] Vasopressin. Desmopressin (DDAVP), as the first vasopressin analog with a very high and very specific antidiuretic effect, has been widely used for different therapeutic purposes. DDAVP also improves human learning and memory processes. CAS Number (desmopressin acetate): 62288-83-9.

ENCOMPASS_PREFERRED
7

CPC Scientific DOTA-DPhe-Cys-Tyr-DTrp-Lys-Thr-Cys-Thr-ol (trifluoroacetate salt) 1MG
SDP

Somatostatin analog DOTA-conjugated for radiolabels such as gallium-67, gallium-68, indium-111, and yttrium-90. This peptide is a useful tool for tumor imaging in radionuclide therapy.SEQUENCE: DOTA-DPhe-Cys-Tyr-DTrp-Lys-Thr-Cys-Thr-ol (trifluoroacetate salt)(Cys2 and 7 bridge)ONE-LETTER SEQUENCE: DOTA-fCYwKTCT-ol (C2&C7 bridge)MOLECULAR FORMULA: C65H90N14O19S2MOLECULAR WEIGHT: 1421.64STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [177943-89-4]SYNONYMS: DOTA-(Tyr3)-Octreotate, DOTATATE, DOTA-(Tyr3,Thr8)-Octreotide, DOTA-[Tyr3] Octreotide Acid (Octreotate)RESEARCH AREA: GastrointestinalREFERENCES:L.Kolby et al., Br. J. Cancer, 93, 1144 (2005)R.Valkema et al., J. Nucl. Med., 46, 83S (2005)M.de Jong et al., J. Nucl. Med., 46, 13S (2005)W.A.Breeman et al., Eur. J. Nucl. Med. Mol. Imaging, 30, 917 (2003)A.Capello et al., Cancer Biother. Radiopharm., 18, 761 (2003)Chinol, M. et al. Semin. Nucl. Med. 32,141(2002)De

ENCOMPASS
8

CPC Scientific DOTA-DPhe-Cys-Tyr-DTrp-Lys-Thr-Cys-Thr-ol (trifluoroacetate salt) 0.5MG
SDP

Somatostatin analog DOTA-conjugated for radiolabels such as gallium-67, gallium-68, indium-111, and yttrium-90. This peptide is a useful tool for tumor imaging in radionuclide therapy.SEQUENCE: DOTA-DPhe-Cys-Tyr-DTrp-Lys-Thr-Cys-Thr-ol (trifluoroacetate salt)(Cys2 and 7 bridge)ONE-LETTER SEQUENCE: DOTA-fCYwKTCT-ol (C2&C7 bridge)MOLECULAR FORMULA: C65H90N14O19S2MOLECULAR WEIGHT: 1421.64STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [177943-89-4]SYNONYMS: DOTA-(Tyr3)-Octreotate, DOTATATE, DOTA-(Tyr3,Thr8)-Octreotide, DOTA-[Tyr3] Octreotide Acid (Octreotate)RESEARCH AREA: GastrointestinalREFERENCES:L.Kolby et al., Br. J. Cancer, 93, 1144 (2005)R.Valkema et al., J. Nucl. Med., 46, 83S (2005)M.de Jong et al., J. Nucl. Med., 46, 13S (2005)W.A.Breeman et al., Eur. J. Nucl. Med. Mol. Imaging, 30, 917 (2003)A.Capello et al., Cancer Biother. Radiopharm., 18, 761 (2003)Chinol, M. et al. Semin. Nucl. Med. 32,141(2002)De

ENCOMPASS
9

Carbosynth LLC. Z-Leu-Leu-Leu-H (aldehyde) (5 mg vial), 1ea, MW: 475.62, Molecular formula: C26H41N3O5, CAS# 133407-82-6
SDP

This item has a minimum order quantity of 3 per supplier requirements
Synonyms: Benzyloxycarbonyl-L-Leucyl-L-Leucyl-L-Leucinal; Cbz-Leu-Leu-Leu-CHO, Z-Leu-Leu-Leu-al, Application: Synthetic Product Inhibitor for Proteasome and Cathepsin, Storage Temperature: -20C, References: K Y. Saito, S. Tsubuki, H. Ito, and S. Kawashima, Neurosci. Lett., 120, 1 (1990), T.J. Jensen, M.A. Loo, S. Pind, D.B. Williams, A.L. Goldberg, and J.R. Riordan, Cell, 83, 129 (1995)., B.J. Votta, M.A. Levy, A. Badger, J. Bradbeer, R.A. Dodds, I.E. James, S. Thompson, M.J.Bossard, T. Carr, J.R. Conner, T.A. Tomaszek, L. Szewczuk, F.H. Drake, D.F. Veber, and M. Gowen, J. Bone Miner. Res., 12, 1396 (1997)

ENCOMPASS_PREFERRED
10

CPC Scientific H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH 0.5MG
SDP

GLP-1 (7-37) is a insulinotropic peptide generated from by precursor GLP-1 (1-37) after proteolytic cleavage. It is secreted by the L cells of intestinal mucosa after food ingestion.SEQUENCE: H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OHONE-LETTER SEQUENCE: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGMOLECULAR FORMULA: C151H228N40O47MOLECULAR WEIGHT: 3355.7STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [106612-94-6]SYNONYMS: Preproglucagon (98-128), Insulinotropin acetate salt, Proglucagon (78-108), Glucagon-Like Peptide 1 (7-37), GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat)RESEARCH AREA: DiabetesREFERENCES:A.Wettergren et al., Regul. Peptides, 77, 83 (1998)A.B.Damholt et al., Endocrinology, 140, 4800 (1999)J.M.Conlon, Regul. Peptides, 93 3 (2000)D.J.Drucker, Gut, 50, 428 (2002)D.J.Drucker, Gastroenterology, 122, 531 (2002)SKU(s): GLUC-016A, GLUC-016B

ENCOMPASS
11

CPC Scientific H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH 1MG
SDP

GLP-1 (7-37) is a insulinotropic peptide generated from by precursor GLP-1 (1-37) after proteolytic cleavage. It is secreted by the L cells of intestinal mucosa after food ingestion.SEQUENCE: H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OHONE-LETTER SEQUENCE: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGMOLECULAR FORMULA: C151H228N40O47MOLECULAR WEIGHT: 3355.7STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [106612-94-6]SYNONYMS: Preproglucagon (98-128), Insulinotropin acetate salt, Proglucagon (78-108), Glucagon-Like Peptide 1 (7-37), GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat)RESEARCH AREA: DiabetesREFERENCES:A.Wettergren et al., Regul. Peptides, 77, 83 (1998)A.B.Damholt et al., Endocrinology, 140, 4800 (1999)J.M.Conlon, Regul. Peptides, 93 3 (2000)D.J.Drucker, Gut, 50, 428 (2002)D.J.Drucker, Gastroenterology, 122, 531 (2002)SKU(s): GLUC-016A, GLUC-016B

ENCOMPASS
12

Cayman Chemical CYM 5478, 1MG
SDP

CYM 5478 | 1-[2-[2,5-dimethyl-1-(phenylmethyl)-1H-pyrrol-3-yl]-2-oxoethyl]-5-(trifluoromethyl)-2(1H)-pyridinone | CAS Number870762-83-7 | Molecular Formula: C21H19F3N2O2 | Formula Weight: 388.4 | Purity: ≥98%

ENCOMPASS_PREFERRED