Peptides
Bachem Fmoc-Glu(OtBu)-Ser(Psi(Me,Me)pro)-OH
Fmoc-Glu(OtBu)-Ser(Psi(Me,Me)pro)-OH, 909115-33-9, C30H36N2O8, Mr 552.62, 5g.
Bachem Fmoc-Glu(OtBu)-Ser(Psi(Me,Me)pro)-OH
Fmoc-Glu(OtBu)-Ser(Psi(Me,Me)pro)-OH, 909115-33-9, C30H36N2O8, Mr 552.62, 25g.
CPC Scientific H-Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 (trifluoroacetate salt) 0.5MG
This peptide was originally isolated from rat brain as an endogenous ligand for two orphan G protein-coupled receptors FM-3/GPR66 and FM-4/TGR-1, which have been identified as neuromedin U (NMU) receptors. hNMS-33 is specifically expressed in the suprachiasmatic nuclei (SCN) of the hypothalamus. It has been shown that NMS is implicated in the regulation of circadian rhythms through autocrine and/or paracrine actions.ONE-LETTER SEQUENCE: ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2MOLECULAR FORMULA: C173H265N53O44MOLECULAR WEIGHT:3791.34STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1138204-27-9], RESEARCH AREA: ObesityREFERENCES: K.Mori et al., EMBO J., 24, 325 (2005)
Medchemexpress LLC GP(33-41) TFA | 99.6% | 1130.19 | 5 MG
GP(33-41) TFA is a 9-amino acid long peptide, which represents the optimal sequence of the GP1 epitope of lymphocytic choriomeningitis virus. This product is intended for research use only.
- Optimal sequence of the GP1 epitope of lymphocytic choriomeningitis virus
- Upregulates H-2Db molecules at RMA-S (Db Kb) cell surface with an SC50 of 344 nM
- Sensitizes MC57 and T2-Db cells to lysis with ED50s of 0.9±0.6 and 2.5±0.7 nM
- Recognized by P14 T cell receptor when presented in the context of H-2D
CPC Scientific H-Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 (trifluoroacetate salt) 1MG
This peptide was originally isolated from rat brain as an endogenous ligand for two orphan G protein-coupled receptors FM-3/GPR66 and FM-4/TGR-1, which have been identified as neuromedin U (NMU) receptors. hNMS-33 is specifically expressed in the suprachiasmatic nuclei (SCN) of the hypothalamus. It has been shown that NMS is implicated in the regulation of circadian rhythms through autocrine and/or paracrine actions.ONE-LETTER SEQUENCE: ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2MOLECULAR FORMULA: C173H265N53O44MOLECULAR WEIGHT:3791.34STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1138204-27-9], RESEARCH AREA: ObesityREFERENCES: K.Mori et al., EMBO J., 24, 325 (2005)
Bachem (Arg13)-Amyloid Beta Protein (1-40) Trifluoroacetate
(Arg13)-Amyloid Beta Protein (1-40) Trifluoroacetate, H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH, 1816939-33-9, C194H300N54O58S, Mr 4348.91, 0.5mg. [Arg13] b-Amyloid (1-40). H13R, a mutation in the metal-binding region of Abeta reduces its copper-mediated toxicity. The native rodent sequence containing an arginine at this position is more tolerant to metals than the human amyloid peptide.
Medchemexpress LLC GP(33-41) TFA | 99.6% | 1130.19 | 10 MG
GP(33-41) TFA is a 9-amino acid-long peptide that represents the optimal sequence of the GP1 epitope of the lymphocytic choriomeningitis virus. It can upregulate H-2Db molecules at the RMA-S (Db Kb) cell surface with an SC50 of 344 nM. In vitro, it sensitizes MC57 and T2-Db cells to lysis with ED50s of 0.9±0.6 and 2.5±0.7 nM, respectively. The P14 TCR recognizes this peptide when presented in the context of H-2D.
- Optimal sequence of the GP1 epitope of lymphocytic choriomeningitis virus
- Upregulates H-2Db molecules at the RMA-S (Db Kb) cell surface
- Sensitizes MC57 and T2-Db cells to lysis with low nanomolar ED50 values
- Recognized by P14 TCR in the context of H-2D
Bachem Annexin A1 (1-25) (dephosphorylated) (human) Trifluoroacetate
Annexin A1 (1-25) (dephosphorylated) (human) Trifluoroacetate, Ac-Ala-Met-Val-Ser-Glu-Phe-Leu-Lys-Gln-Ala-Trp-Phe-Ile-Glu-Asn-Glu-Glu-Gln-Glu-Tyr-Val-Gln-Thr-Val-Lys-OH, 151988-33-9, C141H210N32O44S, Mr 3089.47, 0.5mg. Lipocortin-1 (2-26), Annexin-1 (2-26) (human), Calpactin II (1-25) (dephosphorylated) (human), Ac2-26. Annexin A1 (AnxA1) N-terminal-derived peptide, also known as Ac2-26, mimics the antiinflammatory effects of AnxA1. Ac2-26 can activate all three formyl peptide receptor family members FPR, FPR-like (FPRL)1 and FPRL2 at similar concentations. It represents the first endogenous ligand for FPRL2. In myocardial ischemia-reperfusion injury experiments the peptide showed cardioprotective effects. Understanding the underlying mechanism may help developing novel therapeutics for acute cardioprotection.
Bachem Annexin A1 (1-25) (dephosphorylated) (human) Trifluoroacetate
Annexin A1 (1-25) (dephosphorylated) (human) Trifluoroacetate, Ac-Ala-Met-Val-Ser-Glu-Phe-Leu-Lys-Gln-Ala-Trp-Phe-Ile-Glu-Asn-Glu-Glu-Gln-Glu-Tyr-Val-Gln-Thr-Val-Lys-OH, 151988-33-9, C141H210N32O44S, Mr 3089.47, 1mg. Lipocortin-1 (2-26), Annexin-1 (2-26) (human), Calpactin II (1-25) (dephosphorylated) (human), Ac2-26. Annexin A1 (AnxA1) N-terminal-derived peptide, also known as Ac2-26, mimics the antiinflammatory effects of AnxA1. Ac2-26 can activate all three formyl peptide receptor family members FPR, FPR-like (FPRL)1 and FPRL2 at similar concentations. It represents the first endogenous ligand for FPRL2. In myocardial ischemia-reperfusion injury experiments the peptide showed cardioprotective effects. Understanding the underlying mechanism may help developing novel therapeutics for acute cardioprotection.
Bachem Peptide YY (3-36) (human) Trifluoroacetate
Peptide YY (3-36) (human) Trifluoroacetate, H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2, 123583-37-9, C180H279N53O54, Mr 4049.52, 0.5mg. PYY (3-36) (human). PYY (3-36), a Y2 receptor agonist, is released from the body's gastrointestinal tract in proportion to caloric intake. It has been shown that peripheral injection of PYY (3-36) in rats inhibited food intake and reduced weight gain. In addition, infusion of PYY (3-36) in humans significantly decreased appetite and reduced food intake by 33% over 24h, which suggests that PYY (3-36) has a role in 'longer term' regulation of food intake. Thus, the PYY (3-36) may represent a lead compound for the development of drugs for the treatment of obesity.
Bachem Peptide YY (3-36) (human) Trifluoroacetate
Peptide YY (3-36) (human) Trifluoroacetate, H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2, 123583-37-9, C180H279N53O54, Mr 4049.52, 1mg. PYY (3-36) (human). PYY (3-36), a Y2 receptor agonist, is released from the body's gastrointestinal tract in proportion to caloric intake. It has been shown that peripheral injection of PYY (3-36) in rats inhibited food intake and reduced weight gain. In addition, infusion of PYY (3-36) in humans significantly decreased appetite and reduced food intake by 33% over 24h, which suggests that PYY (3-36) has a role in 'longer term' regulation of food intake. Thus, the PYY (3-36) may represent a lead compound for the development of drugs for the treatment of obesity.
Medchemexpress LLC HY-P1585A 1mg Medchemexpress, Gp100 (25-33), human (TFA) CAS: Purity:>98%
Medchemexpress, HY-P1585A 1mg Gp100 (25-33), human (TFA) CAS: Gp100 (25-33), human TFA is the amino acids 25-33 fragment of the human melanoma antigen. It is a 9-amino acid (AA) epitope restricted by H-2D b and recognized by the T cells [1] . Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.