Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

1,936 – 1,950 of 119,734 results

1,936

Promotions Available

R&D Systems™ Recombinant Human CLEC-2A Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

1,937

Novus Biologicals™ ADAT2 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	ADAT2
Molecular Weight (g/mol)	23.2kDa
Gene ID (Entrez)	134637
Immunogen	ADAT2, 1-191aa. MGSSHHHHHHSSGLVPRGSHMEAKAAPKPAASGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

1,938

Sartorius Recombinant human IGF-1 LR3 protein

RUO Growth Factors and Cytokines

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Powder
Product Type	Recombinant Proteins
For Use With (Application)	Organoid Expansion
Species	Human
Recombinant	Recombinant

1,939

R&D Systems™ Recombinant Cotton Rat MIP-2 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability
Specifications

Purity or Quality Grade	95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	8.0 kDa
Quantity	25 μg
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	E. coli-derived cotton rat CXCL2/GRO beta/MIP-2/CINC-3 protein Ala29-Asn101
Recombinant	Recombinant
Name	CXCL2/GRO beta/MIP-2/CINC-3

1,940

R&D Systems™ Recombinant Mouse CDNF Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

1,941

R&D Systems™ Recombinant Mouse Cardiotrophin-1/CT-1 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

1,942

R&D Systems™ Recombinant Human IL-21 (HEK293 Expressed) Protein

Carrier Free Recombinant Protein

Pricing & Availability
Specifications

Accession Number	Q9HBE4.3
Purity or Quality Grade	>95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie™ Blue Staining.
Conjugate	Unconjugated
Gene Alias	CVID11, IL21, IL-21 Za11interleukin-21, interleukin 21, interleukin-21 isoform, Za11
Molecular Weight (g/mol)	MolecularWeight-observed: 15-17 kDa, under reducing conditions., MolecularWeight-theroretical: 15 kDa
Gene ID (Entrez)	59067
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.
Reconstitution	Reconstitute 10 μg size at 100 μg/mL and other sizes (at 500 μg/mL in PBS.)
Endotoxin Concentration	<0.10 EU / 1 μg of the protein by the LAL method.
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70°C as supplied. 1 month, 2°C to 8°C under sterile conditions after reconstitution. 3 months, -20°C to -70°C under sterile conditions after reconstitution.
For Use With (Application)	Bioactivity
Protein	IL-21
Source	Human embryonic kidney cell, HEK293-derived human IL-21 protein Gln32-Ser162

1,943

Promotions Available

R&D Systems™ Recombinant Human ULBP-3 Fc Chimera Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Binding Activity

Pricing & Availability

1,944

R&D Systems™ Recombinant Human EpCAM/TROP1 Fc Chimera Avi-tag Protein

Biotinylated

Pricing & Availability

1,945

Novus Biologicals™ Recombinant Human CD40/TNFRSF5 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	B cell surface antigen CD40, B-cell surface antigen CD40, Bp50B cell-associated molecule, CD40 antigen, CD40 molecule, TNF receptor superfamily member 5, CD40 type II isoform, CD40L receptor, CDw40, MGC9013, nerve growth factor receptor-related B-lymphocyte activation molecule, p50, TNFRSF5CD40 antigen (TNF receptor superfamily member 5), tumor necrosis factor receptor superfamily member 5, tumor necrosis factor receptor superfamily, member 5
Common Name	CD40/TNFRSF5
Molecular Weight (g/mol)	TMW: 21.6kDa
Gene ID (Entrez)	958
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol, 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

1,946

Novus Biologicals™ Recombinant Human KLF12 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Purity or Quality Grade	>85%, by SDS-PAGE
Conjugate	Unconjugated
Gene Alias	AP-2rep, AP-2rep transcription factor, AP2REPAP-2 repressor, HSPC122, KLF12 zinc finger transcriptional repressor, Krueppel-like factor 12, Kruppel-like factor 12, Transcriptional repressor AP-2rep
Common Name	KLF12
Molecular Weight (g/mol)	TMW: 46.6kDa
Gene ID (Entrez)	11278
Formulation	20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 0.4M UREA
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

1,947

R&D Systems™ Recombinant Mouse IFN-alpha 7/IFNA7 Protein

Measured in an anti-viral assay using L-929 mouse fibroblast cells infected with encephalomyocarditis (EMC) virus.

Pricing & Availability
Specifications

Buffer	Lyophilized from a 0.2 μm filtered solution in PBS
Accession Number	P06799
Purity or Quality Grade	> 95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie™ Blue Staining
Conjugate	Unconjugated
Molecular Weight (g/mol)	18-24 kDa, under reducing conditions
Gene ID (Entrez)	3444
Reconstitution	Reconstitute at 100 μg/mL in PBS
Endotoxin Concentration	< 0.10 EU per 1 μg of the protein by the LAL method
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles
For Use With (Application)	Bioactivity
Species	Mouse
Source	Chinese Hamster Ovary cell line, CHO-derived mouse IFN-alpha 7/IFNA7 protein Cys24-Glu190

1,948

Novus Biologicals™ Recombinant C. elegans SNAP25 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

1,949

Novus Biologicals™ Recombinant Human CD30/TNFRSF8 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability

1,950

Novus Biologicals™ Recombinant E. coli Disulfide oxidoreductase Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

Prev
1
...
128
129
130
131
...
7,983
Next

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ ADAT2 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human CD40/TNFRSF5 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human KLF12 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant C. elegans SNAP25 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human CD30/TNFRSF8 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant E. coli Disulfide oxidoreductase Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ ADAT2 Protein

Novus Biologicals™ Recombinant Human CD40/TNFRSF5 His Protein

Novus Biologicals™ Recombinant Human KLF12 His Protein

Novus Biologicals™ Recombinant C. elegans SNAP25 Protein

Novus Biologicals™ Recombinant Human CD30/TNFRSF8 His Protein

Novus Biologicals™ Recombinant E. coli Disulfide oxidoreductase Protein