
Recombinant Proteins
- (2)
- (1,359)
- (1,337)
- (2)
- (1)
- (13)
- (618)
- (644)
- (61)
- (58)
- (123)
- (1)
- (5)
- (3)
- (421)
- (31)
- (65)
- (1,051)
- (131)
- (5)
- (2)
- (11)
- (1)
- (1,056)
- (11)
Filtered Search Results

Invitrogen™ Human Serine racemase (aa 173-272) Control Fragment Recombinant Protein
Recombinant Protein

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | QVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQ |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human Serine racemase (aa 173-272) Control Fragment |
Recombinant | Recombinant |
Novus Biologicals™ Recombinant Human Serine racemase His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Invitrogen™ Human PLK2, GST Tag Recombinant Protein
Recombinant Protein

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Shipping Condition | Dry Ice |
---|---|
Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
Conjugate | Unconjugated |
Form | Liquid |
Common Name | PLK2 |
Molecular Weight (g/mol) | 105.7 kDa |
KinaseFamily | PLK Kinase Family |
Sequence | Full length |
Concentration | See Label |
Expression System | Baculovirus |
For Use With (Application) | Kinase Assay |
Name | Human PLK2, GST Tag |
Accession Number | Q9NYY3 |
Gene Alias | h PLK-2; hPlk2; hSNK; Plk2; PLK-2; polo like kinase 2; polo-like kinase 1; polo-like kinase 2; Serine/threonine-protein kinase PLK2; serine/threonine-protein kinase SNK; Serum-inducible kinase; SNK |
Gene ID (Entrez) | 10769 |
Formulation | 50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5 |
Protein Tag | GST-tag |
Species | Human |
Recombinant | Recombinant |
Invitrogen™ Human NIM1, GST Tag Recombinant Protein
Recombinant Protein


Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Shipping Condition | Dry Ice |
---|---|
Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
Conjugate | Unconjugated |
Form | Liquid |
Common Name | NIM1 |
Molecular Weight (g/mol) | 75.9 kDa |
KinaseFamily | CAMK Unique Kinase Family |
Sequence | Full length |
Concentration | See Label |
Expression System | Insect cells |
For Use With (Application) | Kinase Assay |
Name | Human NIM1, GST Tag |
Accession Number | Q8IY84 |
Gene Alias | E130304F04Rik; Nim1; NIM1 serine/threonine protein kinase; NIM1 serine/threonine-protein kinase; NIM1K; Serine/threonine-protein kinase NIM1 |
Protein Form | Full Length, Recombinant, Active |
Gene ID (Entrez) | 167359 |
Formulation | 50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5 |
Protein Tag | GST-tag |
Species | Human |
Recombinant | Recombinant |
Invitrogen™ Human TLK1, GST Tag Recombinant Protein
Recombinant Protein


Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
---|---|
Conjugate | Unconjugated |
Form | Liquid |
Common Name | TLK1 |
Molecular Weight (g/mol) | 113 kDa |
Concentration | See Label |
For Use With (Application) | Kinase Assay |
Name | Human TLK1, GST Tag |
Accession Number | Q9UKI8 |
Gene Alias | 4930545J15Rik; E(Sp1) homolog; Enhancer of split groucho-like protein 1; ESG; ESG1; GRG1; KIAA0137; PKU beta; PKU-beta; serine threonine protein kinase; serine/threonine-protein kinase tousled-like 1; SNAK; SNARE protein kinase SNAK; TLE1; TLK1; TLK-1; TLK1B; tousled like kinase 1; tousled-like kinase 1; transducin like enhancer of split 1; transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila); transducin-like enhancer protein 1 |
Gene ID (Entrez) | 9874 |
Formulation | 50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5 |
Protein Tag | GST-tag |
Species | Human |
Recombinant | Recombinant |
Invitrogen™ Human DYRK1A, GST Tag Recombinant Protein
Recombinant Protein


Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
---|---|
Purity or Quality Grade | 85% by SDS-PAGE |
Conjugate | Unconjugated |
Form | Liquid |
Common Name | DYRK1A |
Molecular Weight (g/mol) | 113 kDa |
Sequence | Full length |
Concentration | See Label |
Expression System | Insect cells |
For Use With (Application) | Kinase Assay |
Name | Human DYRK1A, GST Tag |
Accession Number | Q13627 |
Gene Alias | 2310043O08Rik; D16Ertd272e; D16Ertd493e; dual specificity tyrosine phosphorylation regulated kinase 1 A; dual specificity tyrosine-(Y)-phosphorylation regulated kinase 1 A; dual specificity tyrosine-phosphorylation-regulated kinase 1 A; Dual specificity YAK1-related kinase; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1 A; Dyrk; DYRK1; Dyrk1a; ENSMUSG00000074897; Gm10783; hMNB; HP86; mmb; MNB; mnb protein kinase homolog hp86; MNB/DYRK protein kinase; MNBH; MP86; MRD7; OTTHUMP00000109090; Protein kinase minibrain homolog; PSK47; RP86; serine/threonine kinase MNB; serine/threonine-specific protein kinase |
Gene ID (Entrez) | 1859 |
Formulation | 50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5 |
Protein Tag | GST-tag |
Species | Human |
Recombinant | Recombinant |
Invitrogen™ Human VRK2, GST Tag Recombinant Protein
Recombinant Protein


Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Shipping Condition | Dry Ice |
---|---|
Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
Conjugate | Unconjugated |
Form | Liquid |
Common Name | VRK2 |
Molecular Weight (g/mol) | 68.8 kDa |
KinaseFamily | CK1 Kinase Family |
Concentration | See Label |
Expression System | Insect cells |
For Use With (Application) | Kinase Assay |
Name | Human VRK2, GST Tag |
Accession Number | Q86Y07 |
Gene Alias | 2810003O05Rik; AI447698; Serine/threonine-protein kinase VRK2; vaccinia related kinase 2; vaccinia virus B1R-related kinase 2; vaccinia virus BIR kinase related kinase 2; vaccinia-related kinase 2; Vrk2 |
Protein Form | Recombinant, Active, Catalytic |
Protein Length | 1-375 |
Gene ID (Entrez) | 7444 |
Formulation | 50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5 |
Protein Tag | GST-tag |
Species | Human |
Recombinant | Recombinant |
Invitrogen™ Human PIM2, GST Tag Recombinant Protein
Recombinant Protein


Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
---|---|
Conjugate | Unconjugated |
Form | Liquid |
Common Name | PIM2 |
Molecular Weight (g/mol) | 63.7 kDa |
KinaseFamily | PIM Kinase Family |
Sequence | Full length |
Concentration | See Label |
Expression System | Insect cells |
For Use With (Application) | Kinase Assay |
Name | Human PIM2, GST Tag |
Accession Number | Q9P1W9 |
Regulatory Status | RUO - research use only |
Gene Alias | DXCch3; PIM2; Pim-2; pim-2 oncogene; Pim-2 proto-oncogene, serine/threonine kinase; pim-2 h; proto-oncogene Pim-2 (serine threonine kinase); proviral integration site 2; serine/threonine protein kinase pim-2; serine/threonine-protein kinase pim-2 |
Gene ID (Entrez) | 11040 |
Formulation | 50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5 |
Protein Tag | GST-tag |
Species | Human |
Recombinant | Recombinant |
Invitrogen™ Human MKNK1 (MNK1), GST Tag Recombinant Protein
Recombinant Protein


Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Protein Family | Kinases & Inhibitors |
---|---|
Conjugate | Unconjugated |
Form | Liquid |
Common Name | MNK1 |
Molecular Weight (g/mol) | 66.6 kDa |
KinaseFamily | MAPKAPK Kinase Family |
Kinase Group | Ser⁄Thr Kinases: CAMK Group |
Expression System | Insect cells |
For Use With (Application) | Kinase Assay |
Name | Human MKNK1 (MNK1), GST Tag |
Gene Alias | 2410048M24Rik; MAP kinase interacting serine/threonine kinase 1; MAP kinase signal-integrating kinase 1; MAP kinase-interacting serine/threonine kinase 1; MAP kinase-interacting serine/threonine-protein kinase 1; MAPK signal-integrating kinase 1; MKNK1; Mnk1; OTTHUMP00000009675; OTTHUMP00000009676 |
Protein Form | Recombinant, Full Length |
Tag Position | N-Terminal |
Formulation | 50 mM tris with no preservative |
Research Category | Signal Transduction |
Target Gene | MKNK1 |
Species | Human |
Recombinant | Recombinant |
Shipping Condition | Dry Ice |
Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
Quantity | 10 μg |
Sequence | Full length |
Concentration | See Label |
Protein Subtype | Serine/Threonine Kinases |
Accession Number | Q9BUB5 |
Gene ID (Entrez) | 8569 |
Protein Tag | GST-tag |
R&D Systems™ Recombinant Human HGF Activator Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity
R&D Systems™ Human Plasminogen Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity
R&D Systems™ Recombinant Human Complement Component C1s Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity
Invitrogen™ Human TLK2, GST Tag Recombinant Protein
Recombinant Protein


Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
---|---|
Conjugate | Unconjugated |
Form | Liquid |
Common Name | TLK2 |
Molecular Weight (g/mol) | 68.2 kDa |
Concentration | See Label |
Expression System | Baculovirus |
For Use With (Application) | Kinase Assay |
Name | Human TLK2, GST Tag |
Accession Number | Q86UE8 |
Gene Alias | 4933403M19Rik; HsHPK; PKUalpha; PKU-alpha; protein kinase U-alpha; serine/threonine-protein kinase tousled-like 2; Tlk; Tlk2; tousled like kinase 2; tousled-like kinase 2; tousled-like kinase 2 (Arabidopsis) |
Protein Length | 388-end |
Gene ID (Entrez) | 11011 |
Formulation | 50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5 |
Protein Tag | GST-tag |
Species | Human |
Recombinant | Recombinant |
Invitrogen™ Human PASK, GST Tag Recombinant Protein
Recombinant Protein


Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | For research use only. Not for use in diagnostic procedures |
---|---|
Conjugate | Unconjugated |
Form | Liquid |
Molecular Weight (g/mol) | 77.2 kDa |
Formulation | 50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5 |
Concentration | See Label |
For Use With (Application) | Kinase Assay |
Name | Human PASK, GST Tag |
Recombinant | Recombinant |
Invitrogen™ Human RIPK3, GST Tag Recombinant Protein
Recombinant Protein


Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
---|---|
Conjugate | Unconjugated |
Form | Liquid |
Common Name | RIP3 |
Molecular Weight (g/mol) | 83.2 kDa |
Sequence | Full length |
Concentration | See Label |
Expression System | Baculovirus |
For Use With (Application) | Kinase Assay |
Name | Human RIPK3, GST Tag |
Accession Number | Q9Y572 |
Gene Alias | 2610528K09Rik; AW107945; Hcyp2; Homocysteine respondent protein HCYP2; mRIP3; receptor interacting protein 3; receptor interacting serine/threonine kinase 3; receptor-interacting protein 3; receptor-interacting serine/threonine-protein kinase 3; receptor-interacting serine-threonine kinase 3; Rip3; RIP-3; Ripk3; RIP-like protein kinase 3 |
Gene ID (Entrez) | 11035 |
Formulation | 50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5 |
Protein Tag | GST-tag |
Species | Human |
Recombinant | Recombinant |