Trifluoroacetic Acid
Trifluoroacetic acid is a corrosive organofluorine compound that is structurally analogous to, but stronger than, acetic acid. Available in various quantities and reagent grades, it is used in NMR spectroscopy, mass spectrometry, organic synthesis, etc.
Almost 100,000-fold more acidic than acetic acid, TFA is widely used in organic chemistry. TFA is used as a reagent in organic synthesis because of its properties: volatility, organic solvent solubility, and acidic strength. It is less oxidizing than sulfuric acid and is more readily available in its anhydrous form than some other acids . Other features include:
- Used in acid-catalyzed reactions, especially peptide synthesis (to cleave esters)
- Dissolves protein when mixed with liquid SO2
- Removes t-butyl derived side-chain protecting groups in Fmoc peptide synthesis
- Can remove the t-butoxycarbonyl protecting group in organic synthesis
- At low concentrations, acts as an ion-pairing agent for peptides and small proteins in organic compound liquid chromatography
- For acid-stable materials, can be a solvent for NMR spectroscopy
- Acts as a calibrant in mass spectrometry
- Used to produce trifluoroacetate salts
- An ingredient in adhesives, sealants, paints, and coatings
When TFA combines with bases and metals, especially light metals, a strong exothermic reaction occurs. When mixed with lithium aluminum hydride (LAH), the reaction is explosive.
Although nonflammable, TFA is corrosive to skin, eyes, and mucous membranes and requires careful use and handling. It is harmful when inhaled, causes severe skin burns and eye damage, and is toxic to aquatic organisms at even low concentrations.
TFA is also a product of the metabolic breakdown of the anesthetic agent halothane. It is the suspected cause of halothane-induced hepatitis.
Medchemexpress LLC Pardaxin P5 TFA | 67995-63-5 | ≥98% | 3381.87 | 1 MG
Pardaxin P5 TFA is the trifluoroacetate salt form of Pardaxin P5. This antimicrobial peptide is known to inhibit Escherichia coli with a MIC value of 13 μM, making it suitable for anti-infection research.
- Antimicrobial peptide
- Inhibits Escherichia coli with a MIC value of 13 μM
- TFA salt form of Pardaxin P5
- Supplied as a solid
- Specific peptide sequence: GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE
- Soluble in DMSO (100 mg/mL, requires ultrasonic)
- Targets bacterial organisms and anti-infection pathways
Medchemexpress LLC M65 TFA | 99.98% | 4823.53 (free base) | 5 MG
M65 TFA is a deleted peptide of maxadilan (61 a.a.), specifically missing residues between positions 24 and 42. It functions as a specific antagonist of the PACAP type 1 receptor, inhibiting ANP secretion, and is utilized in relevant research.
- Deleted peptide of maxadilan (61 a.a.) with a deletion of residues between positions 24 and 42.
- Acts as a specific antagonist of the PACAP type 1 receptor.
- Inhibits ANP secretion.
- Completely blocks cAMP accumulation stimulated by 100 nM of VIP in rat cortical neurons at 1 μM concentration.
- Partially inhibits cAMP accumulation stimulated by 1 nM of maxadilan in rat cortical neurons at 1 μM concentration.
Medchemexpress LLC G-Pen-GRGDSPCA (TFA) | 98.8% | 948.04 | 5 MG
G-Pen-GRGDSPCA (TFA) is a solid, white to off-white chemical product primarily identified for use as a laboratory chemical and in the manufacture of substances. It demonstrates stability under recommended storage conditions.
- Appearance: white to off-white solid
- Chemical stability: stable under recommended storage conditions
- Identified uses: laboratory chemicals, manufacture of substances
- Purity: 98.76% (LCMS)
- Consistent with structure (LCMS)
Medchemexpress LLC Ac-VDVAD-CHO (TFA) | 00-00-0 | 99.2% | 657.59 g·mol⁻¹ | C25H38F3N5O12 | 5 MG
Ac-VDVAD-CHO (TFA) is a peptide aldehyde inhibitor used in biochemical and cell-based research to block caspase-mediated proteolysis and investigate apoptosis pathways.
- Selective caspase-2 and caspase-3 inhibition (IC50 46 nM and 15 nM).
- TFA salt, supplied as a white to off-white solid.
- High purity (99.2%).
- Molecular weight 657.59 g·mol⁻¹; formula C25H38F3N5O12.
- Recommended storage: powder at -80°C (2 years) or -20°C (1 year).
- For research use only; not for human or clinical use.
Medchemexpress LLC Ant308 (TFA) | 99.6% | 3467.10 | 5 MG
ANT308 TFA is a vasoactive intestinal polypeptide (VIP receptor) antagonist. It significantly enhances the activation and proliferation of T cells, inhibits migration and metastasis, and induces apoptosis of melanoma tumor cells by inhibiting VIP-VPAC2 signaling and reducing the expression of MCAM and N-cadherin. It can be used for the study of acute myeloid leukemia (AML) and uveal melanoma (UVM).
- Reduces the viability of specific cell lines
- Decreases the proportion of cells in the S phase
- Induces apoptosis in certain cell types
- Inhibits cell migration in multiple cell lines
- Reduces MCAM and N-cadherin expression
- Reduces the number and size of liver metastases in animal models
- Shows a trend toward reducing tumor volume in primary tumor sites in animal models
![Medchemexpress LLC L-Prolinamide, N,N-bis(phenylmethyl)glycyl]-4-[4-[[4-[[(phenylmethyl)amino]phosphonomethyl] | 99.9% | 1323.35 | 1 MG](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000386801-logo.png-250.jpg){kind=logo}
Medchemexpress LLC L-Prolinamide, N,N-bis(phenylmethyl)glycyl]-4-[4-[[4-[[(phenylmethyl)amino]phosphonomethyl] | 99.9% | 1323.35 | 1 MG
OncoACP3 TFA from MedChemExpress is a small-molecule ligand of prostatic acid phosphatase (ACP3). This product is applicable to research related to prostate cancer.
- Molecular formula: C62H82F3N12O15P
- Molecular weight: 1323.35
- Appearance: White to off-white solid
- Storage: Powder at -20°C for 3 years; in solvent at -80°C for 6 months, or -20°C for 1 month
- Purity (LCMS): 99.87%
Medchemexpress LLC Vm24-toxin (Vaejovis mexicanus peptide 24) | 1373890-79-9 | 3863.59 | 1 MG
Vm24-toxin (Vaejovis mexicanus peptide 24) is a 36-residue peptide that acts as a potent and selective Kv1.3 blocker with a Kd of approximately 3 pM in lymphocytes. It exhibits over 1500-fold higher affinity for Kv1.3 compared to other assayed potassium channels. Vm24-toxin possesses a distorted cystine-stabilized α/β motif, comprising a single-turn α-helix and a three-stranded antiparallel β-sheet, stabilized by four disulfide bridges. This peptide can attenuate the CD4+ effector memory T cell response to T cell receptor (TCR) stimulation.
- Potent and selective Kv1.3 blocker
- High affinity for Kv1.3 over other potassium channels (>1500-fold)
- Attenuates CD4+ effector memory T cell response to T cell receptor (TCR) stimulation
Waters Corp Proteomics Training Standards, Kit
Waters Corporation Proteomics Training Standards, Kit
Medchemexpress LLC M65 TFA | 99.98% | 4823.53 (free base) | 1 MG
M65 TFA is a deleted peptide of maxadilan (61 a.a.) with a deletion of residues between positions 24 and 42. It acts as a specific antagonist of the PACAP type 1 receptor, inhibiting ANP secretion, and can be utilized for relevant research purposes.
- Specific antagonist of the PACAP type 1 receptor.
- Inhibits ANP secretion.
- Suitable for research.
- In vitro activity: M65 (1 μM) completely blocks cAMP accumulation stimulated by 100 nM of VIP and partially inhibits cAMP accumulation stimulated by 1 nM of maxadilan in rat cortical neurons.
Medchemexpress LLC Pardaxin P5 TFA | ≥96% | 3381.87 (free base) | 5 MG
Pardaxin P5 TFA is the TFA salt form of Pardaxin P5, an antimicrobial peptide that inhibits Escherichia coli with a MIC value of 13 μM. This peptide is for research use only.
- Inhibits Escherichia coli
- Antimicrobial peptide
- Available in solid form
- Molecular weight of 3381.87 (free base)
- Store at -80°C for 2 years (powder) or 6 months (in solvent)