Alkali Metal Salts
- (1)
- (4)
- (1)
- (41)
- (253)
- (11)
- (2)
- (102)
- (1)
- (1)
- (499)
- (1)
- (2)
- (1)
- (1)
- (1)
- (2)
- (38)
- (192)
- (104)
- (1)
- (4)
- (1)
- (14)
- (2)
- (1)
- (751)
- (2)
- (7)
- (59)
- (14)
- (25)
- (1)
- (1)
- (1)
- (2)
- (283)
- (5)
- (2)
- (114)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (4)
- (13)
- (72)
- (1)
- (1)
- (15)
- (6)
- (624)
- (66)
- (2)
- (2)
- (1)
- (1)
- (7)
- (1)
- (4)
- (2)
- (1)
- (1)
- (475)
- (70)
- (4)
- (1)
- (1)
- (3)
- (1)
- (299)
- (7)
- (26)
- (5)
- (37)
- (1)
- (1)
- (75)
- (1)
- (4)
- (6)
- (1)
- (1)
- (153)
- (1)
- (2)
- (1)
- (44)
- (5)
- (1)
- (2)
- (11)
- (2)
- (1)
- (74)
- (2)
- (1)
- (3)
- (233)
- (185)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (222)
- (160)
- (4)
- (3)
- (6)
- (1,357)
- (1)
- (204)
- (14)
- (18)
- (4)
- (5)
- (6)
- (41)
- (6)
- (3)
- (7)
- (1)
- (1)
- (3)
- (53)
- (4)
- (2)
- (2)
- (18)
- (1)
- (2)
- (3)
- (1)
- (1)
- (41)
- (4)
- (71)
- (1)
- (1)
- (6)
- (2)
- (4)
- (8)
- (55)
- (1)
- (4)
- (20)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (2)
- (115)
- (1)
- (6)
- (16)
- (1)
- (6)
- (1)
- (1)
- (1)
- (1)
- (10)
- (21)
- (4)
- (4)
- (1)
- (1)
- (1)
- (1)
- (3)
- (1)
- (13)
- (2)
- (1)
- (2)
- (3)
- (5)
- (2)
- (3)
- (4)
- (90)
- (40)
- (1)
- (3)
- (12)
- (2)
- (2)
- (25)
- (8)
- (2)
- (3)
- (2)
- (4)
- (14)
- (24)
- (20)
- (2)
- (1)
- (2)
- (1)
- (5)
- (32)
- (13)
- (1)
- (2)
- (13)
- (6)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (1)
- (23)
- (8)
- (2)
- (2)
- (17)
- (2)
- (1)
- (43)
- (112)
- (3)
- (5)
- (2)
- (1)
- (19)
- (2)
- (1)
- (1)
- (8)
- (7)
- (4)
- (3)
- (3)
- (16)
- (1)
- (4)
- (2)
- (60)
- (11)
- (1)
- (61)
- (17)
- (2)
- (1)
- (4)
- (86)
- (4)
- (2)
- (134)
- (9)
- (1)
- (2)
- (3)
- (13)
- (3)
- (2)
- (1)
- (33)
- (2)
- (39)
- (11)
- (10)
- (4)
- (3)
- (3)
- (4)
- (13)
- (5)
- (8)
- (1)
- (2)
- (4)
- (4)
- (3)
- (1)
- (12)
- (11)
- (3)
- (3)
- (19)
- (68)
- (2)
- (42)
- (2)
- (1)
- (2)
- (1)
- (3)
- (3)
- (2)
- (2)
- (2)
- (7)
- (4)
- (3)
- (5)
- (1)
- (1)
- (2)
- (14)
- (1)
- (1)
- (4)
- (3)
- (10)
- (1)
- (53)
- (105)
- (3)
- (2)
- (1)
- (16)
- (6)
- (10)
- (12)
- (3)
- (87)
- (1)
- (1)
- (16)
- (7)
- (2)
- (1)
- (1)
- (1)
- (4)
- (1)
- (2)
- (2)
- (1)
- (6)
- (10)
- (5)
- (2)
- (1)
- (2)
- (2)
- (7)
- (2)
- (2)
- (60)
- (3)
- (10)
- (2)
- (1)
- (64)
- (1)
- (2)
- (2)
- (29)
- (1)
- (2)
- (1)
- (174)
- (2)
- (1)
- (5)
- (1)
- (16)
- (5)
- (8)
- (2)
- (2)
- (1)
- (2)
- (11)
- (4)
- (5)
- (1)
- (1)
- (2)
- (1)
- (2)
- (8)
- (15)
- (1)
- (4)
- (2)
- (6)
- (2)
- (57)
- (1)
- (2)
- (2)
- (8)
- (3)
- (3)
- (3)
- (1)
- (1)
- (20)
- (10)
- (7)
- (3)
- (3)
- (3)
- (2)
- (5)
- (2)
- (5)
- (1)
- (2)
- (2)
- (12)
- (1)
- (6)
- (2)
- (2)
- (1)
- (4)
- (14)
- (1)
- (1)
- (2)
- (1)
- (2)
- (3)
- (5)
- (2)
- (9)
- (9)
- (3)
- (1)
- (1)
- (3)
- (4)
- (3)
- (9)
- (14)
- (1)
- (2)
- (2)
- (14)
- (25)
- (6)
- (40)
- (2)
- (2)
- (2)
- (2)
- (3)
- (2)
- (1)
- (2)
- (1)
- (3)
- (3)
- (5)
- (7)
- (3)
- (2)
- (6)
- (3)
- (23)
- (3)
- (1)
- (2)
- (1)
- (2)
- (28)
- (13)
- (14)
- (4)
- (5)
- (7)
- (1)
- (4)
- (1)
- (7)
- (1)
- (8)
- (2)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (2)
- (4)
- (2)
- (1)
- (5)
- (8)
- (2)
- (3)
- (2)
- (1)
- (1)
- (2)
- (2)
- (2)
- (2)
- (15)
- (2)
- (6)
- (1)
- (1)
- (8)
- (1)
- (14)
- (2)
- (2)
- (22)
- (1)
- (1)
- (2)
- (2)
- (3)
- (3)
- (64)
- (32)
- (11)
- (32)
- (3)
- (6)
- (1)
- (10)
- (8)
- (2)
- (11)
- (2)
- (4)
- (2)
- (6)
- (19)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (2)
- (1)
- (2)
- (14)
- (7)
- (3)
- (1)
- (44)
- (3)
- (1)
- (5)
- (5)
- (7)
- (25)
- (5)
- (3)
- (1)
- (1)
- (6)
- (3)
- (4)
- (9)
- (1)
- (5)
- (6)
- (11)
- (3)
- (3)
- (16)
- (13)
- (1)
- (2)
- (2)
- (3)
- (7)
- (2)
- (13)
- (1)
- (4)
- (1)
- (1)
- (4)
- (4)
- (5)
- (1)
- (1)
- (3)
- (2)
- (30)
- (1)
- (10)
- (42)
- (8)
- (5)
- (3)
- (20)
- (16)
- (1)
- (5)
- (2)
- (1)
- (1)
- (4)
- (2)
- (5)
- (2)
- (1)
- (2)
- (1)
- (4)
- (1)
- (2)
- (5)
- (2)
- (1)
- (5)
- (1)
- (6)
- (2)
- (12)
- (26)
- (7)
- (1)
- (2)
- (2)
- (2)
- (2)
- (892)
- (378)
- (1)
- (5)
- (1)
- (4)
- (2)
- (4)
- (3)
- (1)
- (98)
- (1)
- (214)
- (90)
- (26)
- (4)
- (7)
- (1)
- (10)
- (2)
- (46)
- (28)
- (5)
- (5)
- (189)
- (139)
- (1)
- (2)
- (19)
- (1)
- (1)
- (3)
- (3)
- (3)
- (1)
- (2)
- (189)
- (141)
- (17)
- (48)
- (3)
- (28)
- (2)
- (8)
- (181)
- (29)
- (34)
- (5)
- (15)
- (40)
- (3)
- (20)
- (4)
- (21)
- (6)
- (42)
- (177)
- (51)
- (1)
- (664)
- (3)
- (1)
- (12)
- (5)
- (3)
- (9)
- (3)
- (159)
- (1)
- (2)
- (49)
- (11)
- (4)
- (143)
- (1)
- (9)
- (12)
- (16)
- (1)
- (71)
- (38)
- (10)
- (2)
- (5)
- (2)
- (21)
- (6)
- (1)
- (3)
- (2)
- (2)
- (2)
- (3)
- (1)
- (2)
- (7)
- (4)
- (2)
- (4)
- (11)
- (4)
- (1)
- (2)
- (2)
- (2)
- (2)
- (3)
- (4)
- (1)
- (16)
- (1)
- (6)
- (7)
- (2)
- (11)
- (4)
- (6)
- (1)
- (2)
- (3)
- (38)
- (3)
- (1)
- (14)
- (1)
- (1)
- (1)
- (125)
- (4)
- (3)
- (23)
- (4)
- (3)
- (2)
- (4)
- (3)
- (2)
- (6)
- (39)
- (2)
- (3)
- (20)
- (1)
- (2)
- (465)
- (3)
- (1)
- (2)
- (7)
- (11)
- (2)
- (1)
- (1)
- (103)
- (1)
- (1)
- (3)
- (1)
- (2)
- (1)
- (24)
- (2)
- (2)
- (1)
- (2)
- (4)
- (80)
- (9)
- (1)
- (3)
- (3)
- (3)
- (2)
- (2)
- (3)
- (7)
- (3)
- (11)
- (17)
- (2)
- (6)
- (4)
- (1)
- (2)
- (4)
- (2)
- (1)
- (2)
- (6)
- (1)
- (8)
- (2)
- (25)
- (3)
- (3)
- (5)
- (2)
- (2)
- (3)
- (1)
- (1)
- (1)
- (9)
- (19)
- (1)
- (23)
- (13)
- (1)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (3)
- (8)
- (2)
- (5)
- (3)
- (3)
- (3)
- (5)
- (4)
- (5)
- (12)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (3)
- (1)
- (1)
- (1)
- (4)
- (4)
- (5)
- (1)
- (5)
- (4)
- (1)
- (2)
- (1)
- (3)
- (4)
- (2)
- (4)
- (21)
- (8)
- (5)
- (1)
- (53)
- (1)
- (1)
- (2)
- (1)
- (9)
- (1)
- (1)
- (7)
- (1)
- (3)
- (1)
- (1)
- (4)
- (1)
- (8)
- (4)
- (1)
- (1)
- (4)
- (1)
- (4)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (3)
- (1)
- (2)
- (1)
- (1)
- (3)
- (5)
- (2)
- (2)
- (1)
- (1)
- (5)
- (2)
- (3)
- (2)
- (2)
- (2)
- (13)
- (2)
- (3)
- (4)
- (3)
- (6)
- (1)
- (1)
- (6)
- (5)
- (2)
- (2)
- (3)
- (4)
- (4)
- (1)
- (4)
- (1)
- (3)
- (4)
- (1)
- (4)
- (3)
- (1)
- (2)
- (2)
- (3)
- (1)
- (2)
- (11)
- (2)
- (6)
- (5)
- (17)
- (4)
- (1)
- (1)
- (1)
- (4)
- (26)
- (2)
- (4)
- (3)
- (4)
- (3)
- (6)
- (1)
- (4)
- (3)
- (72)
- (1)
- (1)
- (40)
- (2)
- (6)
- (4)
- (124)
- (4)
- (3)
- (1)
- (4)
- (1)
- (33)
- (13)
- (18)
- (47)
- (1)
- (1)
- (30)
- (279)
- (8)
- (2)
- (8)
- (1)
- (12)
- (6)
- (1)
- (1)
- (1)
- (5)
- (3)
- (1)
- (12)
- (8)
- (1)
- (1)
- (9)
- (4)
- (34)
- (11)
- (119)
- (6)
- (15)
- (51)
- (2)
- (27)
- (14)
- (11)
- (1)
- (7)
- (537)
- (2)
- (1)
- (35)
- (2)
- (5)
- (8)
- (7)
- (3)
- (17)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (18)
- (1)
- (3)
- (2)
- (2)
- (4)
- (3)
- (2)
- (1)
- (45)
- (1)
- (2)
- (3)
- (7)
- (1)
- (5)
- (1)
- (4)
- (8)
- (7)
- (9)
- (103)
- (2)
- (5)
- (4)
- (1)
- (22)
- (5)
- (3)
- (2)
- (2)
- (3)
- (22)
- (2)
- (6)
- (58)
- (18)
- (8)
- (20)
- (13)
- (3)
- (15)
- (6)
- (46)
- (28)
- (2)
- (9)
- (9)
- (2)
- (2)
- (13)
- (1)
- (19)
- (2)
- (58)
- (28)
- (1)
- (4)
- (2)
- (2)
- (2)
- (2)
- (7)
- (4)
- (2)
- (10)
- (2)
- (9)
- (34)
- (3)
- (1)
- (57)
- (7)
- (2)
- (2)
- (14)
- (2)
- (4)
- (399)
- (16)
- (1)
- (4)
- (1)
- (5)
- (372)
- (6)
- (85)
- (2)
- (2)
- (4)
- (21)
- (1)
- (4)
- (23)
- (2)
- (2)
- (3)
- (3)
- (247)
- (2)
- (17)
- (3)
- (12)
- (2)
- (16)
- (4)
- (2)
- (7)
- (53)
- (4)
- (8)
- (72)
- (3)
- (9)
- (2)
- (2)
- (2)
- (1)
- (3)
- (3)
- (11)
- (3)
- (2)
- (15)
- (19)
- (5)
- (207)
- (3)
- (635)
- (2)
- (17)
- (3)
- (3)
- (3)
- (2)
- (21)
- (2)
- (670)
- (3)
- (3)
- (5)
- (6)
- (5)
- (5)
- (6)
- (8)
- (18)
- (87)
- (2)
- (1)
- (1)
- (2)
- (4)
- (569)
- (22)
- (2)
- (2)
- (2)
- (5)
Filtered Search Results
Medchemexpress LLC Alginate lyase | 9024-15-1 | ≥10000 U/g | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Alginate lyase is a polysaccharide lyase that catalyzes the degradation of alginate. It can be used for the research of cystic fibrosis by degrading the polysaccharide biofilm of *Pseudomonas aeruginosa*.
- Catalyzes the degradation of alginate
- Used for the research of cystic fibrosis
- Degrades polysaccharide biofilm of *Pseudomonas aeruginosa*
- Appearance: Solid
- Color: Light yellow to light brown
- Solubility: H2O : ≥ 2.5 mg/mL
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Sodium nitroprusside | 14402-89-2 | MFCD00003506 | 99.99% | 500 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Sodium nitroprusside | 14402-89-2 | MFCD00003506 | 99.99% | 500 MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC TMRM Perchlorate | 115532-50-8 | 99.7% | 1 ML
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
TMRM Perchlorate is a rapidly and selectively mitochondrial membrane potential fluorescent probe that exhibits red fluorescence. Rhodamine dyes, including TMRM Perchlorate, are membrane-permeable cationic fluorescent probes that specifically recognize mitochondrial membrane potentials, attaching to mitochondria and producing bright fluorescence. At certain concentrations, rhodamine dyes demonstrate low toxicity to cells, making them suitable for detecting mitochondria in animal cells, plant cells, and microorganisms.
- Membrane-permeable cationic fluorescent probe.
- Specifically recognizes mitochondrial membrane potentials.
- Attaches to mitochondria and produces bright fluorescence.
- Low toxicity to cells at certain concentrations.
- Used to detect mitochondria in animal cells, plant cells, and microorganisms.
- Rapidly and selectively targets mitochondrial membrane potential.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Sigma Aldrich Fine Chemicals Biosciences Potassium carbonate reagent grade, >=98%, powder, -325 mesh | 584-08-7 | MFCD00011382 | 250G
Potassium carbonate reagent grade, >=98%, powder, -325 mesh | Purity: >=98% | Mol Wt: 138.21 | 584-08-7 | MFCD00011382 | 250G
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
SUPELCO INC SODIUM HYPOCHLORITE SOLUTION
NC1917871 SODIUM HYPOCHLORITE SOLUTION
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Zebra Technologies Corporation Label, Polypropylene, 1.5x0.5in (38.1x12.7mm); TT, PolyPro 3000T, Coated, Permanent Adhesive, 1in (25.4mm) core, 3780/roll, 8/box, Plain
This item has a minimum order quantity of 8 per supplier requirements
Label, Polypropylene, 1.5x0.5in (38.1x12.7mm); TT, PolyPro 3000T, Coated, Permanent Adhesive, 1in (25.4mm) core, 3780/roll, 8/box, Plain
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
ALADDIN SCIENTIFIC CORPORATION Sodium chloride, 100g
Sodium Chloride (NaCl) is widely used in biochemistry and molecular biology applications It is found in nature in all body tissue and is considered an essential nutrient Used in a wide variety of biochemical applications including creating density gradients regulating biological functions and as a diluent to increase ionic strength in buffers or culture media NaCl is a component of phosphate buffered saline (PBS)and SSC buffer It has also been used for precipitation of DNA from SDS-containing samples and in the removal of small nucleic acid fragments from plasmid DNA preparations The use of sodium chloride for isolation of DNA from mammalian cells has been described Recent studies provide evidence that a high amount of NaCl reduces production of nitric oxide Usually used in biochemistry and molecular biology applications a component of PBS and SSC buffers
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Apexbio Technology LLC Lithium carbonate 554-13-2 500g
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Lithium carbonate (CAS 554-13-2) is a small-molecule inhibitor targeting inositol monophosphatase and glycogen synthase kinase-3 (GSK-3 ) It is designed to modulate intracellular signaling pathways thereby regulating processes including cell proliferation differentiation and apoptosis Lithium carbonate exerts its biological activity primarily through inhibition of inositol monophosphatase in the phosphatidylinositol signaling cascade and modulation of GSK-3 activity Based on these pharmacological properties lithium carbonate holds research potential in neuroscience psychiatric biology and cell signaling pathway studies particularly those involving inositol metabolism and GSK-3 -dependent regulation
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
GE Betz, Inc. POTASSIUM IODIDE-IODATE 1ML=.5
POTASSIUM IODIDE-IODATE 1ML=.5MG SO3 1L
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Amylin, amide, human | 122384-88-7 | >98.3% | 3903.28 | 500 UG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Amylin, amide, human is a 37-amino acid polypeptide, a pancreatic hormone cosecreted with insulin. It plays crucial roles in metabolism and glucose homeostasis, inhibiting glucagon secretion, delaying gastric emptying, and acting as a satiety agent.
- Appearance: Solid
- Color: White to off-white
- Chemical formula: C165H261N51O55S2
- Sequence shortening: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7)
- Inhibits glucagon secretion
- Delays gastric emptying
- Acts as a satiety agent
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
![Research Products International Corp ADP [Adenosine-5'-diphosphate, disodium salt dihydrate], 10 Grams](https://assets.fishersci.com/TFS-Assets/CCG/product-images/VN00006095-A11220-10.0.JPG-250.jpg)
Research Products International Corp ADP [Adenosine-5'-diphosphate, disodium salt dihydrate], 10 Grams
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
CAS Number: 16178-48-6
Molecular Formula: C10H13N5O10P2Na2 • 2H2O
Molecular Weight: 507.2
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Research Products International Corp Dextran Sulfate Sodium Salt, 50 Grams
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Produced from Dextran 500,000 MW. Tested for use in nucleic acid hybridizations.
Free sulfate content: <0.02%
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
![Research Products International Corp EDTA Disodium Salt [Ethylenediaminetetra-acetic acid, disodium salt dihydrate], 500 Grams](https://assets.fishersci.com/TFS-Assets/CCG/product-images/VN00006095-E57020-500.05.JPG-250.jpg)
Research Products International Corp EDTA Disodium Salt [Ethylenediaminetetra-acetic acid, disodium salt dihydrate], 500 Grams
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
CAS Number: 6381-92-6
Molecular Formula: C10H14N2O8Na2 • 2H2O
Molecular Weight: 372.2
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Research Products International Corp Dextran Sulfate Sodium Salt, 100 Grams
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Produced from Dextran 500,000 MW. Tested for use in nucleic acid hybridizations.
Free sulfate content: <0.02%
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Research Products International Corp SODIUM CHLORIDE, 1KG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Sodium chloride (NaCl) is a highly soluble, white crystalline salt (58.44 g/mol) used in life science labs to maintain osmotic balance and ionic strength. It is essential in buffers, cell culture media, nucleic acid extraction, protein purification, and electrophoresis, where consistent ionic conditions support biochemical and molecular processes.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More