Alkali Metal Salts
- (1)
- (4)
- (1)
- (40)
- (249)
- (11)
- (2)
- (97)
- (1)
- (1)
- (488)
- (1)
- (2)
- (1)
- (1)
- (1)
- (2)
- (38)
- (181)
- (105)
- (2)
- (1)
- (14)
- (2)
- (1)
- (726)
- (2)
- (7)
- (51)
- (10)
- (25)
- (1)
- (1)
- (1)
- (2)
- (283)
- (5)
- (2)
- (114)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (13)
- (71)
- (1)
- (1)
- (15)
- (6)
- (623)
- (65)
- (1)
- (2)
- (1)
- (1)
- (7)
- (1)
- (4)
- (2)
- (1)
- (1)
- (457)
- (70)
- (4)
- (1)
- (1)
- (3)
- (1)
- (287)
- (7)
- (24)
- (5)
- (37)
- (1)
- (1)
- (75)
- (1)
- (4)
- (6)
- (1)
- (1)
- (153)
- (1)
- (1)
- (44)
- (1)
- (1)
- (2)
- (11)
- (2)
- (1)
- (74)
- (2)
- (3)
- (220)
- (184)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (206)
- (160)
- (4)
- (2)
- (4)
- (1,342)
- (1)
- (200)
- (13)
- (18)
- (4)
- (5)
- (6)
- (40)
- (6)
- (3)
- (7)
- (1)
- (1)
- (3)
- (53)
- (4)
- (2)
- (2)
- (15)
- (1)
- (2)
- (3)
- (1)
- (41)
- (4)
- (71)
- (1)
- (1)
- (6)
- (2)
- (4)
- (8)
- (55)
- (1)
- (4)
- (20)
- (1)
- (1)
- (2)
- (2)
- (1)
- (3)
- (1)
- (1)
- (2)
- (115)
- (1)
- (4)
- (16)
- (6)
- (1)
- (1)
- (1)
- (10)
- (21)
- (4)
- (1)
- (1)
- (3)
- (1)
- (8)
- (1)
- (2)
- (3)
- (5)
- (2)
- (3)
- (4)
- (90)
- (40)
- (1)
- (3)
- (12)
- (2)
- (19)
- (8)
- (2)
- (3)
- (2)
- (4)
- (14)
- (24)
- (20)
- (2)
- (2)
- (5)
- (32)
- (13)
- (1)
- (2)
- (13)
- (6)
- (2)
- (5)
- (1)
- (1)
- (23)
- (8)
- (2)
- (2)
- (17)
- (2)
- (1)
- (43)
- (112)
- (3)
- (5)
- (2)
- (1)
- (19)
- (2)
- (1)
- (8)
- (7)
- (4)
- (3)
- (3)
- (16)
- (1)
- (4)
- (2)
- (59)
- (11)
- (61)
- (17)
- (2)
- (1)
- (4)
- (86)
- (4)
- (2)
- (134)
- (9)
- (1)
- (2)
- (3)
- (13)
- (3)
- (2)
- (1)
- (33)
- (2)
- (39)
- (11)
- (10)
- (4)
- (3)
- (3)
- (13)
- (5)
- (8)
- (1)
- (2)
- (4)
- (3)
- (3)
- (12)
- (11)
- (3)
- (2)
- (19)
- (68)
- (2)
- (42)
- (2)
- (1)
- (1)
- (3)
- (3)
- (2)
- (2)
- (2)
- (7)
- (4)
- (3)
- (5)
- (1)
- (2)
- (14)
- (1)
- (1)
- (4)
- (3)
- (7)
- (1)
- (53)
- (105)
- (3)
- (2)
- (1)
- (16)
- (6)
- (10)
- (12)
- (3)
- (87)
- (1)
- (16)
- (7)
- (2)
- (4)
- (1)
- (2)
- (2)
- (6)
- (10)
- (5)
- (2)
- (1)
- (2)
- (2)
- (7)
- (2)
- (2)
- (60)
- (3)
- (10)
- (2)
- (1)
- (64)
- (1)
- (2)
- (2)
- (29)
- (2)
- (1)
- (174)
- (2)
- (1)
- (5)
- (1)
- (16)
- (5)
- (8)
- (2)
- (2)
- (1)
- (2)
- (11)
- (4)
- (5)
- (1)
- (1)
- (2)
- (2)
- (8)
- (15)
- (1)
- (4)
- (2)
- (6)
- (57)
- (1)
- (2)
- (2)
- (8)
- (2)
- (3)
- (3)
- (1)
- (20)
- (10)
- (7)
- (3)
- (3)
- (3)
- (2)
- (5)
- (2)
- (5)
- (1)
- (2)
- (2)
- (12)
- (6)
- (2)
- (2)
- (1)
- (4)
- (14)
- (1)
- (2)
- (1)
- (2)
- (5)
- (2)
- (9)
- (9)
- (1)
- (3)
- (4)
- (3)
- (9)
- (14)
- (1)
- (2)
- (2)
- (14)
- (25)
- (6)
- (40)
- (2)
- (2)
- (2)
- (2)
- (3)
- (2)
- (1)
- (2)
- (1)
- (3)
- (3)
- (5)
- (7)
- (3)
- (2)
- (6)
- (3)
- (23)
- (3)
- (1)
- (2)
- (2)
- (28)
- (13)
- (14)
- (4)
- (5)
- (7)
- (4)
- (7)
- (1)
- (8)
- (2)
- (1)
- (1)
- (2)
- (1)
- (2)
- (4)
- (2)
- (1)
- (5)
- (8)
- (2)
- (3)
- (2)
- (1)
- (1)
- (2)
- (2)
- (2)
- (2)
- (15)
- (2)
- (6)
- (1)
- (8)
- (1)
- (14)
- (2)
- (2)
- (22)
- (1)
- (1)
- (2)
- (2)
- (3)
- (3)
- (64)
- (32)
- (11)
- (32)
- (3)
- (4)
- (10)
- (8)
- (2)
- (11)
- (2)
- (4)
- (2)
- (6)
- (19)
- (1)
- (2)
- (2)
- (1)
- (2)
- (1)
- (1)
- (14)
- (7)
- (3)
- (1)
- (43)
- (3)
- (1)
- (5)
- (5)
- (7)
- (25)
- (5)
- (3)
- (1)
- (1)
- (6)
- (3)
- (4)
- (9)
- (1)
- (5)
- (6)
- (11)
- (3)
- (16)
- (13)
- (2)
- (2)
- (3)
- (7)
- (2)
- (13)
- (4)
- (1)
- (4)
- (4)
- (5)
- (1)
- (1)
- (3)
- (1)
- (30)
- (1)
- (9)
- (42)
- (8)
- (5)
- (3)
- (20)
- (16)
- (1)
- (5)
- (2)
- (1)
- (1)
- (4)
- (2)
- (5)
- (2)
- (1)
- (2)
- (1)
- (4)
- (1)
- (2)
- (5)
- (1)
- (1)
- (5)
- (1)
- (6)
- (2)
- (12)
- (26)
- (1)
- (2)
- (2)
- (2)
- (2)
- (4)
- (49)
- (6)
- (6)
- (8)
- (3)
- (9)
- (1)
- (3)
- (7)
- (4)
- (5)
- (2)
- (5)
- (2)
- (3)
- (1)
- (1)
- (4)
- (1)
- (1)
- (7)
- (7)
- (1)
- (2)
- (2)
- (2)
- (17)
- (5)
- (8)
- (2)
- (3)
- (2)
- (2)
- (3)
- (43)
- (9)
- (2)
- (1)
- (6)
- (2)
- (4)
- (15)
- (10)
- (3)
- (10)
- (3)
- (1)
- (21)
- (2)
- (2)
- (892)
- (378)
- (1)
- (5)
- (1)
- (4)
- (2)
- (4)
- (3)
- (1)
- (98)
- (1)
- (214)
- (90)
- (26)
- (4)
- (7)
- (1)
- (10)
- (2)
- (46)
- (28)
- (5)
- (5)
- (189)
- (139)
- (1)
- (2)
- (19)
- (1)
- (1)
- (3)
- (3)
- (3)
- (1)
- (2)
- (189)
- (141)
- (17)
- (48)
- (3)
- (28)
- (2)
- (8)
- (181)
- (29)
- (34)
- (5)
- (15)
- (40)
- (3)
- (20)
- (4)
- (21)
- (6)
- (42)
- (177)
- (51)
- (1)
- (664)
- (3)
- (1)
- (12)
- (5)
- (3)
- (9)
- (3)
- (159)
- (1)
- (2)
- (49)
- (11)
- (4)
- (143)
- (1)
- (9)
- (12)
- (16)
- (71)
- (38)
- (10)
- (2)
- (5)
- (2)
- (21)
- (6)
- (1)
- (3)
- (2)
- (2)
- (2)
- (3)
- (1)
- (2)
- (7)
- (4)
- (2)
- (4)
- (11)
- (4)
- (2)
- (2)
- (2)
- (2)
- (3)
- (4)
- (1)
- (15)
- (6)
- (7)
- (2)
- (11)
- (4)
- (6)
- (1)
- (2)
- (3)
- (34)
- (3)
- (14)
- (1)
- (1)
- (1)
- (125)
- (4)
- (3)
- (23)
- (4)
- (3)
- (2)
- (4)
- (3)
- (2)
- (6)
- (35)
- (2)
- (3)
- (20)
- (1)
- (2)
- (465)
- (3)
- (1)
- (2)
- (7)
- (11)
- (2)
- (1)
- (1)
- (102)
- (1)
- (1)
- (3)
- (1)
- (2)
- (1)
- (23)
- (2)
- (2)
- (1)
- (2)
- (80)
- (9)
- (1)
- (3)
- (3)
- (3)
- (2)
- (2)
- (3)
- (7)
- (3)
- (11)
- (17)
- (2)
- (6)
- (4)
- (1)
- (2)
- (4)
- (2)
- (2)
- (3)
- (1)
- (8)
- (2)
- (20)
- (3)
- (3)
- (5)
- (2)
- (2)
- (3)
- (1)
- (1)
- (1)
- (8)
- (19)
- (23)
- (13)
- (1)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (3)
- (8)
- (2)
- (5)
- (3)
- (3)
- (3)
- (5)
- (4)
- (5)
- (12)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (3)
- (1)
- (1)
- (1)
- (4)
- (4)
- (5)
- (1)
- (5)
- (4)
- (1)
- (2)
- (1)
- (3)
- (4)
- (2)
- (4)
- (21)
- (8)
- (5)
- (1)
- (53)
- (1)
- (1)
- (2)
- (9)
- (1)
- (1)
- (7)
- (1)
- (3)
- (1)
- (1)
- (4)
- (1)
- (8)
- (4)
- (1)
- (1)
- (4)
- (1)
- (4)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (3)
- (1)
- (2)
- (1)
- (1)
- (3)
- (5)
- (2)
- (2)
- (1)
- (1)
- (5)
- (2)
- (3)
- (2)
- (2)
- (2)
- (13)
- (2)
- (3)
- (4)
- (3)
- (6)
- (1)
- (1)
- (6)
- (5)
- (2)
- (2)
- (3)
- (4)
- (4)
- (1)
- (4)
- (1)
- (3)
- (4)
- (1)
- (4)
- (3)
- (1)
- (2)
- (2)
- (3)
- (1)
- (2)
- (11)
- (2)
- (6)
- (5)
- (17)
- (4)
- (1)
- (1)
- (1)
- (4)
- (25)
- (2)
- (4)
- (3)
- (4)
- (3)
- (6)
- (1)
- (4)
- (3)
- (68)
- (1)
- (1)
- (37)
- (2)
- (6)
- (4)
- (123)
- (4)
- (3)
- (1)
- (4)
- (1)
- (33)
- (13)
- (18)
- (47)
- (1)
- (1)
- (30)
- (269)
- (8)
- (2)
- (8)
- (1)
- (12)
- (6)
- (1)
- (1)
- (1)
- (5)
- (3)
- (1)
- (12)
- (8)
- (1)
- (1)
- (9)
- (4)
- (34)
- (11)
- (119)
- (6)
- (15)
- (51)
- (2)
- (27)
- (14)
- (11)
- (1)
- (7)
- (534)
- (2)
- (1)
- (35)
- (2)
- (5)
- (8)
- (7)
- (3)
- (17)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (18)
- (1)
- (3)
- (2)
- (2)
- (4)
- (3)
- (2)
- (1)
- (45)
- (1)
- (2)
- (3)
- (7)
- (1)
- (5)
- (1)
- (4)
- (8)
- (7)
- (9)
- (103)
- (2)
- (5)
- (4)
- (1)
- (22)
- (5)
- (3)
- (2)
- (2)
- (3)
- (22)
- (1)
- (6)
- (58)
- (16)
- (8)
- (20)
- (11)
- (3)
- (15)
- (5)
- (46)
- (23)
- (2)
- (9)
- (8)
- (2)
- (2)
- (13)
- (19)
- (58)
- (27)
- (1)
- (4)
- (1)
- (2)
- (2)
- (2)
- (7)
- (4)
- (2)
- (10)
- (2)
- (9)
- (34)
- (3)
- (1)
- (57)
- (7)
- (2)
- (2)
- (14)
- (2)
- (4)
- (399)
- (16)
- (1)
- (4)
- (1)
- (5)
- (372)
- (6)
- (85)
- (2)
- (2)
- (4)
- (21)
- (1)
- (4)
- (23)
- (2)
- (2)
- (3)
- (3)
- (247)
- (2)
- (17)
- (3)
- (12)
- (2)
- (16)
- (4)
- (2)
- (7)
- (53)
- (4)
- (8)
- (72)
- (3)
- (9)
- (2)
- (2)
- (2)
- (1)
- (3)
- (3)
- (11)
- (3)
- (2)
- (15)
- (19)
- (5)
- (207)
- (3)
- (635)
- (2)
- (17)
- (3)
- (3)
- (3)
- (2)
- (21)
- (2)
- (670)
- (3)
- (3)
- (5)
- (6)
- (5)
- (5)
- (6)
- (8)
- (18)
- (87)
- (2)
- (1)
- (1)
- (2)
- (4)
- (569)
- (22)
- (2)
- (2)
- (2)
- (5)
Filtered Search Results
Medchemexpress LLC Potassium bromide | 7758-02-3 | MFCD00011358 | 500g
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Potassium bromide 99% is a salt widely used as an anticonvulsant and a sedative Potassium bromide is a redox reagent that can be used to remove peripheral membrane proteins in molecular biology[1][2]
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Alkali Scientific Potassium Phosphate, Dibasic, Anhydrous, 3 Kg
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Potassium Phosphate Dibasic, Anhydrous (3 kg), is a laboratory-grade salt used to prepare phosphate buffer solutions, nutrient media, and for controlling pH in chemical reactions. The 3 kg size is well-suited for medium-volume applications, providing a reliable supply of potassium and phosphate ions for various biochemical assays, microbiological culture media, and plant research. Its anhydrous nature ensures that no water content affects the concentration of solutions, making it an excellent choice for precise buffer preparation. Potassium Phosphate Dibasic is frequently used in studies of enzyme activity, plant growth, and other applications where phosphate is a key component.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Alkali Scientific 4 Methylumbelliferyl 2 Acetamido 2 Deoxy 6 Sulfate β D Glucopyranoside Sodium Salt, 25 Milligrams
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Methylumbelliferyl 2-Acetamido-2-Deoxy-6-Sulfate β-D-Glucopyranoside Sodium Salt (25 mg) is a fluorogenic substrate used to detect enzymatic activity, particularly for sulfatases. This reagent is widely employed in assays where the detection of sulfate groups in glycosaminoglycans or other sulfated polysaccharides is required. Upon enzyme cleavage, the substrate generates a fluorescent signal, providing a highly sensitive method for studying sulfatase activity in biochemical and cell-based assays. The 25 mg quantity is ideal for small-scale experiments and allows for a range of biochemical analyses in research laboratories.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
![eMolecules 534-17-8 | Cesium carbonate (99+%-Cs) | Strem Chemicals | MFCD00010957 | 325.819 | CCs2O3 | 99.000 | [Cs+].[Cs+].[O-]C([O-])=O | 100g | 321343023](https://assets.fishersci.com/TFS-Assets/CCG/product-images/NC2049202.JPG-250.jpg)
eMolecules 534-17-8 | Cesium carbonate (99+%-Cs) | Strem Chemicals | MFCD00010957 | 325.819 | CCs2O3 | 99.000 | [Cs+].[Cs+].[O-]C([O-])=O | 100g | 321343023
Cesium carbonate (99+%-Cs) | Strem Chemicals | 534-17-8 | MFCD00010957 | 325.819 | CCs2O3 | 99.000 | [Cs+].[Cs+].[O-]C([O-])=O | 100g | 321343023
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Amylin, amide, human TFA | 98.8% | 4017.30 | 1 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Amylin, amide, human TFA is a 37-amino acid polypeptide and a pancreatic hormone that is cosecreted with insulin. It plays unique roles in metabolism and glucose homeostasis by inhibiting glucagon secretion, delaying gastric emptying, and acting as a satiety agent. This product is for research use only and not sold to patients.
- Inhibits glucagon secretion
- Delays gastric emptying
- Acts as a satiety agent
- Stimulates human amylin receptor CTR1 and CTR2 in MCF-7 cells with an EC50 of 35.2 ± 7.5 nM
- Exhibits a half-time of 23 minutes in Swiss male mice after subcutaneous injection
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Amylin, amide, human | 122384-88-7 | >98.3% | 3903.28 | 500 UG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Amylin, amide, human is a 37-amino acid polypeptide, a pancreatic hormone cosecreted with insulin. It plays crucial roles in metabolism and glucose homeostasis, inhibiting glucagon secretion, delaying gastric emptying, and acting as a satiety agent.
- Appearance: Solid
- Color: White to off-white
- Chemical formula: C165H261N51O55S2
- Sequence shortening: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7)
- Inhibits glucagon secretion
- Delays gastric emptying
- Acts as a satiety agent
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Med Vet International 0.9% Sodium Chloride Injection 1000mL bag
VET LICENSE NEEDS TO BE PROVIDED IN 3-4 BUSINESS DAYS OR ORDER WILL BE CANCELLED
Limit 2 per customer per our shipping policy. If additional quantity is ordered, actual freight cost will be charged. Product is not manufacture specific
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
AAPPTEC SIEBER AMIDE RESIN 1G
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
NC2736883 SIEBER AMIDE RESIN 1G
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Sigma Aldrich Fine Chemicals Biosciences Sodium acetate trihydrate EMPROVE(R) Expert, Ph. Eur., BP, ChP, JP, USP | Mol Wt: 136.08 | 6131-90-4 | MFCD00071557 |
Sodium acetate trihydrate EMPROVE(R) Expert, Ph. Eur., BP, ChP, JP, USP | 6131-90-4 | MFCD00071557 |
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Alkali Scientific Succinyl Chloride, 1 Kilogram
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Succinyl Chloride is an acid chloride used as a reagent in organic synthesis. It is highly reactive and is commonly employed in the production of succinyl derivatives, which are used in pharmaceutical, chemical, and biotechnological applications. Succinyl chloride is particularly important in the synthesis of peptides and other bioactive compounds, serving as an acylating agent in peptide synthesis and enzyme modification. This 1-kilogram quantity is suitable for large-scale chemical processes and research projects. It is essential for the production of intermediates used in pharmaceuticals, cosmetics, and agrochemicals.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Alkali Scientific Sodium Perchlorate, ACS Grade, 100 G
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Sodium Perchlorate, ACS Grade, is a high-purity inorganic salt used as an oxidizing agent in chemical synthesis and laboratory applications. This reagent is widely used in oxidative reactions, particularly in the preparation of perchlorate salts and other highly reactive compounds. Sodium perchlorate is also employed in certain environmental testing protocols, including those requiring oxidation reactions for the breakdown of organic contaminants. The high purity of this 100g package ensures consistent performance in demanding applications. Sodium perchlorate is an essential reagent for laboratories involved in inorganic chemistry, analytical testing, and chemical synthesis where controlled oxidation is required.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
![eMolecules 584-08-7 | Potassium carbonate, anhydrous | Chem-Impex | MFCD00011382 | 138.205 | CK2O3 | 99.000 | [K+].[K+].[O-]C([O-])=O | 5kg | 288407351](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000129311.jpg-250.jpg)
eMolecules 584-08-7 | Potassium carbonate, anhydrous | Chem-Impex | MFCD00011382 | 138.205 | CK2O3 | 99.000 | [K+].[K+].[O-]C([O-])=O | 5kg | 288407351
Potassium carbonate, anhydrous | Chem-Impex | 584-08-7 | MFCD00011382 | 138.205 | CK2O3 | 99.000 | [K+].[K+].[O-]C([O-])=O | 5kg | 288407351
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 497-19-8 | Sodium carbonate | Chem-Impex | MFCD00003494 | 105.988 | CNa2O3 | 25.000 | [Na+].[Na+].[O-]C([O-])=O | 1kg | 112536317
Sodium carbonate | Chem-Impex | 497-19-8 | MFCD00003494 | 105.988 | CNa2O3 | 25.000 | [Na+].[Na+].[O-]C([O-])=O | 1kg | 112536317
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
![eMolecules 7558-79-4 | Sodium phosphate dibasic, anhydrous | Chem-Impex | MFCD00003496 | 141.957 | HNa2O4P | 99.000 | [Na+].[Na+].OP([O-])([O-])=O | 10kg | 342450078](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000129369.jpg-250.jpg)
eMolecules 7558-79-4 | Sodium phosphate dibasic, anhydrous | Chem-Impex | MFCD00003496 | 141.957 | HNa2O4P | 99.000 | [Na+].[Na+].OP([O-])([O-])=O | 10kg | 342450078
Sodium phosphate dibasic, anhydrous | Chem-Impex | 7558-79-4 | MFCD00003496 | 141.957 | HNa2O4P | 99.000 | [Na+].[Na+].OP([O-])([O-])=O | 10kg | 342450078
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Aobchem AOBCHEM
5001093998 POTASSIUM BENZYLTRIFLUOROBORAT
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More