Phenols
Medchemexpress LLC Cresol red | 1733-12-6 | 99.3% | 100 MG
Cresol red, 97% is an anionic dye utilized as a pH indicator. It changes from orange to yellow at pH 1.8-2.0 and from yellow to purple at pH 7.0-8.8.
- Anionic dye
- Functions as a pH indicator
- Changes color based on pH: orange to yellow at pH 1.8-2.0; yellow to purple at pH 7.0-8.8
- For research use only; not sold to patients
Medchemexpress LLC 3-(2-Pyridyldithio)propanoic acid | 68617-64-1 | 99.5% | 1 G
3-(2-Pyridyldithio)propanoic acid is an alkyl chain-based PROTAC linker designed for use in the synthesis of PROTACs. PROTACs are molecules that contain two different ligands connected by a linker, utilizing the intracellular ubiquitin-proteasome system to selectively degrade target proteins.
- Alkyl chain-based PROTAC linker
- Used in the synthesis of PROTACs
- For research use only
Medchemexpress LLC C-Type Natriuretic Peptide (1-53), human TFA | 141294-77-1 | 99.94% | 5801.77 | 10 MG
C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. This natriuretic peptide family peptide is involved in the maintenance of electrolyte-fluid balance and vascular tone.
- Molecular formula: C251H417N81O71S3.xC2HF3O2
- Appearance: Solid
- Color: White to off-white
- Sequence (shortened): DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys37-Cys55)
- Solubility: H2O: 50 mg/mL (ultrasonic needed)
- Target: Angiotensin receptor
- Pathway: GPCR/G protein
Medchemexpress LLC Camptothecin-20S-O-p 25mg | 194414-69-2 | 25 MG
Camptothecin-20(S)-O-propionate (CZ48) is the C20-propionate ester of camptothecin that functions as a topoisomerase I inhibitor and has reported antitumor activity in animal models. It is provided as a solid and as prepared solutions for research use, with recommended storage to maintain stability.
- Acts as a topoisomerase I inhibitor
- Demonstrated antitumor activity in breast and prostate carcinoma models
- Available as solid and 10 mM DMSO solution formulations
- High purity suitable for research (reported ~99.5%)
- Stable under recommended storage: powder -20°C for long term, solvent -80°C
Medchemexpress LLC N-(p-Coumaroyl) Serotonin | 68573-24-0 | 99.0% | 50 MG
N-(p-Coumaroyl) Serotonin is a selective inhibitor of PDGFRβ, ERK1/2, and caspase-8, exhibiting antioxidant, anti-atherosclerotic, and anti-inflammatory properties. It inhibits glioblastoma cells and demonstrates anti-inflammatory activity in RAW264.7 cells. The compound works by inhibiting PDGF signaling, blocking Ca2+ influx, and inducing apoptosis, making it suitable for glioblastoma and atherosclerosis research.
- Selective inhibitor of PDGFRβ, ERK1/2, and caspase-8
- Possesses antioxidant, anti-atherosclerotic, and anti-inflammatory properties
- Inhibits glioblastoma cells
- Reduces PDGF signaling and blocks Ca2+ influx
- Induces apoptosis through caspase-8 activation
- Improves atherosclerosis and aortic wall enlargement
Medchemexpress LLC NPR2 Human P. past 2ug
NPR2 Protein Human (P pastoris His) serves as the receptor for C-type natriuretic peptide NPPC/CNP activating guanylate cyclase upon ligand binding NPR2 potentially regulates skeletal growth indicating involvement in bone development Its interaction with C-type natriuretic peptide highlights its significance in mediating cellular responses especially in signaling pathways influencing skeletal growth dynamics NPR2 Protein Human (P pastoris His) is the recombinant human-derived Atrial natriuretic peptide receptor 2/NPR2 expressed by P pastoris with N-His labeled tag
Medchemexpress LLC 4-hydroxybenzaldehyde | 123-08-0 | MFCD00006939 | 100.0% | 122.12 g/mol | C7H6O2 | 500mg
p-Hydroxybenzaldehyde (Standard) is the analytical standard of p-Hydroxybenzaldehyde This product is intended for research and analytical applications p-Hydroxybenzaldehyde is a one of the major components in vanilla aroma with antagonistic effect on GABAA receptor of the 1 2 2S subtype at high concentrations
eMolecules 16694-46-5 | Ethyl formimidate hydrochloride | Oakwood Chemicals | MFCD00192154 | 109.550 | C3H8ClNO | 95.000 | Cl.CCOC=N | 1g | 480149766
Ethyl formimidate hydrochloride | Oakwood Chemicals | 16694-46-5 | MFCD00192154 | 109.550 | C3H8ClNO | 95.000 | Cl.CCOC=N | 1g | 480149766
eMolecules 123-11-5 | p-Anisaldehyde | Chem-Impex | MFCD00003385 | 136.150 | C8H8O2 | 98.000 | COc1ccc(C=O)cc1 | 25g | 490847545
p-Anisaldehyde | Chem-Impex | 123-11-5 | MFCD00003385 | 136.150 | C8H8O2 | 98.000 | COc1ccc(C=O)cc1 | 25g | 490847545
Medchemexpress LLC N-(4-Bromphenyl)-3-phenylpropanamid | 316146-27-7 | 98.11% | 304.19 | 50 G
N-(4-Bromphenyl)-3-phenylpropanamid is a drug intermediate for the synthesis of various active compounds. It is intended for research use only.
- Solid appearance
- White to off-white color
- High purity
- Stable for long-term storage
Medchemexpress LLC 3-(2-Pyridyldithio)propanoic Acid | 68617-64-1 | 99.5% | 10 G
3-(2-Pyridyldithio)propanoic Acid is an alkyl chain-based PROTAC linker that can be used in the synthesis of PROTACs. PROTACs contain two different ligands connected by a linker; one is a ligand for an E3 ubiquitin ligase and the other is for the target protein. PROTACs exploit the intracellular ubiquitin-proteasome system to selectively degrade target proteins.
- Target: PROTAC linkers
- Pathway: PROTAC
- Molecular weight: 215.29
- Formula: C8H9NO2S2
- Appearance: Solid
- Color: White to off-white
- Solubility (in vitro): DMSO: 250 mg/mL
![eMolecules 10523-68-9 | 2-Aminoadamantane hydrochloride | Oakwood Chemical187.710 | C10H18ClN | 98.000 | Cl.NC1[C@H]2C[C@@H]3C[C@@H](C[C@H]1C3)C2 | 1g | 603242446](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502143354.JPG-250.jpg)
eMolecules 10523-68-9 | 2-Aminoadamantane hydrochloride | Oakwood Chemical187.710 | C10H18ClN | 98.000 | Cl.NC1[C@H]2C[C@@H]3C[C@@H](C[C@H]1C3)C2 | 1g | 603242446
2-Aminoadamantane hydrochloride | Oakwood Chemical | 10523-68-9187.710 | C10H18ClN | 98.000 | Cl.NC1[C@H]2C[C@@H]3C[C@@H](C[C@H]1C3)C2 | 1g | 603242446
Apexbio Technology LLC P 22077 1247819-59-5 10mM (in 1mL DMSO)
P 22077 (CAS 1247819-59-5) is a small molecule inhibitor targeting ubiquitin-specific protease 7 (USP7 also known as HAUSP) and to a lesser extent deubiquitinase USP4 USP7 modulates the stability of several regulatory proteins including p53 impacting apoptosis pathways in cancer biology P 22077 demonstrates potent USP7 inhibition with IC values of 8 6 nM in singleplex and 7 8 nM in multiplex in vitro assays and shows minimal activity against related enzymes DEN1 and SENP2core Cellular studies suggest that P 22077-mediated USP7 inhibition destabilizes Tip60 attenuating p53-dependent apoptosis The compound is currently utilized in preclinical research investigating the role of deubiquitination in tumorigenesis
Medchemexpress LLC P-CAB agent 2 | 1978371-23-1 | C22H25FN2O4S | 50 MG
P-CAB agent 2 is a potent and orally active potassium-competitive acid blocker and a gastric acid secretion inhibitor. It inhibits H+/K+-ATPase activity and the hERG potassium channel. This agent shows no acute toxicity and inhibits histamine-induced gastric acid secretion.
- Potent and orally active potassium-competitive acid blocker
- Gastric acid secretion inhibitor
- Inhibits H+/K+-ATPase activity with an IC50 value of <100 nM
- Inhibits the hERG potassium channel with an IC50 value of 18.69 μM
- Shows no acute toxicity
- Inhibits histamine-induced gastric acid secretion