Cresols
Medchemexpress LLC (-)-p-Bromotetramisole oxalate | 62284-79-1 | 99.9% | 373.22 | 25 MG
(-)-p-Bromotetramisole oxalate (L-p-Bromotetramisole oxalate; 6-Bromolevamisole oxalate) is an alkaline phosphatase inhibitor. It is applicable for research related to erythroleukemia. It potently inhibits purified human liver, bone, spleen, and kidney alkaline phosphatase isoenzymes.
- Inhibits terminal cell division-associated MEL DS-19 cell differentiation
- Reduces B+ cell levels
- Minimally inhibits purified human intestinal and placental alkaline phosphatase isoenzymes
Medchemexpress LLC P-Selectin Rhesus M 10ug
P-Selectin Protein Rhesus Macaque (HEK293 His) is a member of the selectin family of cell adhesion molecules P-selectin (CD62P) has an N-terminal lectin domain an epidermal growth factor motif (generally) nine regulatory protein repeats a transmembrane section and a short intracytoplasmic tail P-selectin mediates leukocyte rolling on stimulated endothelial cells and heterotypic aggregation of activated platelets onto leukocytes P-selectin mediates heterotypic aggregation of activated platelets to cancer cells and adhesion of cancer cells to stimulated endothelial cells P-selectin glycoprotein ligand-1 (PSGL-1) is a major ligand for P-selectin[1][2][3] P-Selectin Protein Rhesus Macaque (HEK293 His) is the recombinant Rhesus Macaque-derived P-Selectin protein expressed by HEK293 with C-His labeled tag
Medchemexpress LLC P-Selectin Human H 100ug
P-selectin is a Ca(2 )-dependent receptor on myeloid cells that critically binds to sialic acid-Lewis X on neutrophils and monocytes promoting the interaction between activated endothelial cells or platelets and leukocytes interaction This binding primarily to SELPLG/PSGL1 and PODXL2 is critical for rapid rolling of leukocytes during early inflammation P-Selectin Protein Human (HEK293 Fc) is the recombinant human-derived P-Selectin protein expressed by HEK293 with C-hFc labeled tag
Medchemexpress LLC 5-O-(E)-p-coumaroylquinic acid | 5746-55-4 | 99.9% | 338.31 g/mol | C16H18O8 | 10 MG
5-O-(E)-p-Coumaroylquinic acid is a quinic acid derivative reported to inhibit hepatitis B virus. Supplied as a high-purity research reagent in powder form, it is intended for in vitro antiviral and phytochemical studies and should be handled using standard laboratory safety procedures.
- High purity (≈99.9%) powder for research use.
- Reported antiviral activity against hepatitis B virus.
- Molecular weight 338.31 g/mol; formula C16H18O8.
- Supplied in milligram-scale packages suitable for small-scale experiments.
- Storage: powder at -20°C for long-term storage, 4°C for short-term storage.
Apexbio Technology LLC P 22077 1247819-59-5 10mg
P 22077 (CAS 1247819-59-5) is a small molecule inhibitor targeting ubiquitin-specific protease 7 (USP7 also known as HAUSP) and to a lesser extent deubiquitinase USP4 USP7 modulates the stability of several regulatory proteins including p53 impacting apoptosis pathways in cancer biology P 22077 demonstrates potent USP7 inhibition with IC values of 8 6 nM in singleplex and 7 8 nM in multiplex in vitro assays and shows minimal activity against related enzymes DEN1 and SENP2core Cellular studies suggest that P 22077-mediated USP7 inhibition destabilizes Tip60 attenuating p53-dependent apoptosis The compound is currently utilized in preclinical research investigating the role of deubiquitination in tumorigenesis
eMolecules 123-11-5 | p-Anisaldehyde | Oakwood Chemical | MFCD00003385 | 136.150 | C8H8O2 | 99.000 | COc1ccc(C=O)cc1 | 1g | 893916867
p-Anisaldehyde | Oakwood Chemical | 123-11-5 | MFCD00003385 | 136.150 | C8H8O2 | 99.000 | COc1ccc(C=O)cc1 | 1g | 893916867
Medchemexpress LLC Phenol, 4-amino-3-methyl- | 2835-99-6 | ≥98.0% | 123.15 | 25 G
4-Amino-m-cresol inhibits soil urease activity. It is for research use only.
- Inhibits soil urease activity
- Appearance: Solid
- Color: White to off-white
- Purity: ≥98.0%
- Storage: 4°C, protect from light. In solvent: -80°C, 6 months; -20°C, 1 month (protect from light)
eMolecules 123-11-5 | p-Anisaldehyde | Chem-Impex | MFCD00003385 | 136.150 | C8H8O2 | 98.000 | COc1ccc(C=O)cc1 | 250g | 490847547
p-Anisaldehyde | Chem-Impex | 123-11-5 | MFCD00003385 | 136.150 | C8H8O2 | 98.000 | COc1ccc(C=O)cc1 | 250g | 490847547
Medchemexpress LLC C-Type Natriuretic Peptide (1-53), human TFA | 141294-77-1 | 99.94% | 5801.77 | 10 MG
C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. This natriuretic peptide family peptide is involved in the maintenance of electrolyte-fluid balance and vascular tone.
- Molecular formula: C251H417N81O71S3.xC2HF3O2
- Appearance: Solid
- Color: White to off-white
- Sequence (shortened): DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys37-Cys55)
- Solubility: H2O: 50 mg/mL (ultrasonic needed)
- Target: Angiotensin receptor
- Pathway: GPCR/G protein
Medchemexpress LLC TL02-59 | 1315330-17-6 | 99.9% | 609.64 | 1 MG
TL02-59 is an orally active, selective Src-family kinase Fgr inhibitor with an IC50 of 0.03 nM. It also inhibits Lyn and Hck with IC50s of 0.1 nM and 160 nM, respectively. It is known to potently suppress acute myelogenous leukemia (AML) cell growth.
- Orally active, selective Src-family kinase Fgr inhibitor
- Inhibits Lyn and Hck
- Potently suppresses acute myelogenous leukemia (AML) cell growth
- Inhibits Fgr autophosphorylation in TF-1 cells
- Induces growth arrest in primary AML bone marrow samples
- Eliminates AML cells from the spleen and peripheral blood in a mouse model of AML
- Potential therapeutic agent for acute myelogenous leukemia (AML)
Apexbio Technology LLC EZ Cap Mouse CD80 mRNA (m1Ψ HA tag) 5x1mg (1mg/mL)
Mouse CD80 mRNA encodes CD80P Binding to CD28 and CTLA-4 receptors on T cells CD80 modulates T-cell activation and inhibition CD80 interacting with CD28 promotes T-cell activation and proliferation enhancing immune responses Its binding to CTLA-4 provides inhibitory signals maintaining immune tolerance and preventing excessive immune reactions CD80 have emerged as therapeutic targets in various immunotherapies such as treatments for autoimmune diseases transplantation rejection and cancer immunotherapy EZ Cap Mouse CD80 mRNA (m1 HA tag) is provided at 1 mg/mL and expresses mouse CD86 cytokine fused with an HA tag facilitating subsequent detection It contains a cap 1 structure generated via co-transcriptional capping Incorporation of modified nucleotides m1 along with a poly (A) tail minimizes RNA-induced innate immune activation and enhances mRNA stability and lifespan both in vitro and in vivo
Cambridge Isotope Laboratories 4-Chloro-3-methylphenol (ring-2 6-D2 98%) 0 01 g
4-Chloro-3-methylphenol (ring-2 6-D2 98%) 0 01 g
Medchemexpress LLC M-PEG-mal (MW 30000) | 98.0% | 500 MG
M-PEG-mal (MW 30000) is a PEG-based PROTAC linker utilized in the synthesis of PROTACs. PROTACs consist of two distinct ligands joined by a linker; one ligand targets an E3 ubiquitin ligase, and the other targets a specific protein. These molecules leverage the intracellular ubiquitin-proteasome system for selective degradation of target proteins.
- PEG-based PROTAC linker
- Enables synthesis of PROTACs
- Utilizes the ubiquitin-proteasome system
- Degrades target proteins selectively
- Features two ligands connected by a linker
- One ligand for E3 ubiquitin ligase, one for target protein