Cresols
Medchemexpress LLC N-(4-phenyl-1,2,3,4-tetrahydronaphthalen-2-yl)propanamide | 134865-74-0 | MFCD00901545 | >99.0% | 279.38 g/mol | C19H21NO | 50 MG
4-P-PDOT is a potent, selective melatonin MT2 receptor antagonist used as an analytical standard and research reagent. It exhibits >300-fold selectivity for MT2 over MT1 and is supplied in small quantities suitable for biochemical and pharmacological studies; consult the Certificate of Analysis for purity and storage.
- Potent and selective MT2 antagonist.
- High receptor selectivity (>300-fold) for MT2 versus MT1.
- Intended for use as an analytical standard and research reagent.
- Available in small packaging sizes, including 50 mg.
- Molecular formula C19H21NO and molecular weight 279.38 g/mol.
- CAS number 134865-74-0 for unambiguous identification.
Sigma Aldrich Fine Chemicals Biosciences m-Cresol >=98%, FG | 108-39-4 | MFCD00002302 | 25KG
m-Cresol >=98%, FG | Purity: >=98% | Mol Wt: 108.14 | 108-39-4 | MFCD00002302 | 25KG
Selleck Chemical LLC 740 Y-P
740 Y-P (PDGFR 740Y-P 740YPDGFR) is a cell-permeable phosphopeptide activator of PI3K
Sigma Aldrich Fine Chemicals Biosciences 2-Methoxy-4-methylphenol >=98%, FG | 93-51-6 | MFCD00002378 | 1KG
2-Methoxy-4-methylphenol >=98%, FG | Purity: >=98% | Mol Wt: 138.16 | 93-51-6 | MFCD00002378 | 1KG
Sigma Aldrich Fine Chemicals Biosciences 2-Methoxy-4-methylphenol >=98%, FG | 93-51-6 | MFCD00002378 | 100G
2-Methoxy-4-methylphenol >=98%, FG | Purity: >=98% | Mol Wt: 138.16 | 93-51-6 | MFCD00002378 | 100G
Medchemexpress LLC C-Type Natriuretic Peptide (1-53), human TFA | 141294-77-1 | 99.94% | 5801.77 | 10 MG
C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. This natriuretic peptide family peptide is involved in the maintenance of electrolyte-fluid balance and vascular tone.
- Molecular formula: C251H417N81O71S3.xC2HF3O2
- Appearance: Solid
- Color: White to off-white
- Sequence (shortened): DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys37-Cys55)
- Solubility: H2O: 50 mg/mL (ultrasonic needed)
- Target: Angiotensin receptor
- Pathway: GPCR/G protein
Cambridge Isotope Laboratories 5-Isopropyl-2-methylphenol (isopropyl-13C3 99%) 1 mg/mL in methanol 1 2 mL
5-Isopropyl-2-methylphenol (isopropyl-13C3 99%) 1 mg/mL in methanol 1 2 mL
Medchemexpress LLC Tri(2-methylphenyl)phosphine | 6163-58-2 | 99.99% | C21H21P | 50 G
Tri(2-methylphenyl)phosphine is an organic phosphorus ligand that can be utilized as a drug intermediate to form complexes with metal salts. It is intended for research use only and not sold to patients.
- Organic phosphorus ligand
- Utilized as a drug intermediate
- Forms complexes with metal salts
- For research use only
Medchemexpress LLC NY-ESO-1 (157-165) peptide TFA | 97.6% | 1208.37 | 10 MG
NY-ESO-1 (157-165) peptide (TFA) is a peptide fragment from the NY-ESO-1 protein. It can activate the immune system, particularly in HLA-A2 positive individuals, by being recognized by CD8+ T cells, thereby triggering an immune response. This peptide is expressed in various tumors and can be utilized as a target for tumor immunotherapy.
- Peptide fragment from NY-ESO-1 protein
- Activates the immune system in HLA-A2 positive individuals
- Recognized by CD8+ T cells, triggering an immune response
- Expressed in various tumors
- Can be used as a target for tumor immunotherapy
- Highly immunogenic epitope of NY-ESO-1
- Can induce spontaneous or vaccine-induced T cell immune responses
Cayman Chemical 4-hydroxy Nebivolol hydrochl
A major metabolite of nebivolol; formed by the hydroxylation of nebivolol by CYP2D6
Selleck Chemical LLC Pifithrin-μ S2930-50mg
Pifithrin- (NSC 303580 PFT 2-Phenylethynesulfonamide) is a specific p53 inhibitor by reducing its affinity to Bcl-xL and Bcl-2 and also inhibits HSP70 function and autophagy
Medchemexpress LLC T3-ATA S-isomer 10mM 1mL | 2438721-48-1 | 1 ML
T3-ATA (S-isomer) is the S-isomer of T3-ATA, a thyroid-hormone analog that acts on thyroid hormone receptors. It is supplied for research use as a DMSO solution (commonly 10 mM, 1 mL) and should be stored protected from light and under inert atmosphere per manufacturer recommendations.
- S-isomer of T3-ATA, the active form of the thyroid hormone.
- Molecular formula: C19H16I3NO6S; molecular weight: 767.11.
- Provided as DMSO solution; soluble in DMSO (≥ 50 mg/mL).
- Purity indicated by COA: 99.5%.
- Storage: 4°C protected from light; in solvent store at -80°C (6 months) or -20°C (1 month).
- Intended for research use only.