
SPE Plates
- (8)
- (12)
- (30)
- (15)
- (1)
- (1)
- (1)
- (1)
- (1)
- (10)
- (13)
- (49)
- (1)
- (1)
- (1)
- (24)
- (1)
- (1)
- (9)
- (57)
- (1)
- (1)
- (5)
- (2)
- (10)
- (10)
- (3)
- (13)
- (9)
- (8)
- (6)
- (1)
- (7)
- (8)
- (1)
- (7)
- (4)
- (4)
- (5)
- (4)
- (11)
- (10)
- (9)
- (1)
- (1)
- (2)
- (4)
- (3)
- (2)
- (2)
- (5)
- (5)
- (5)
- (5)
- (4)
- (102)
- (38)
- (19)
- (5)
- (3)
- (6)
- (18)
- (1)
- (113)
- (1)
- (29)
- (2)
- (17)
- (2)
- (2)
- (5)
- (19)
- (1)
- (15)
- (26)
- (1)
- (1)
- (3)
Filtered Search Results

Thermo Scientific™ HyperSep™ SPE Plates
Innovative HyperSep™ Solid Phase Extraction Plates deliver clean, highly reproducible sample extracts with lower elution volumes—for greater sensitivity, reliability and cost savings.
Type | 96-well Plate |
---|---|
Bed Weight | 10 mg |
For Use With (Application) | Bioanalytical Applications - Weak Ion-Exchange Retention of Strong Acidic Compounds. Sorbent Charge Can be Activated or Deactivated. Complementary Reversed Phase Retention of Neutral Compounds |
Product Line | HyperSep |
Thermo Scientific™ HyperSep™ Retain CX Plates
Achieve consistent, high recoveries for basic compounds with these Thermo Scientific™ HyperSep™ Retain CX Plates.
Particle Size | 30 to 50 μm |
---|---|
Type | Solid Phase Extraction Well Plate |
Volume (Metric) Well | 1 mL |
Sorbent | HyperSep Sulfonic Acid-Modified Polystyrene DVB |
For Use With (Application) | Retention of Basic Analytes |
Product Line | HyperSep |
Thermo Scientific™ HyperSep™ Aminopropyl Plates
Obtain excellent retention of drugs, metabolites and structural isomers with these aminopropyl SPE well plates that allow both polar and anion exchange interactions.
Particle Size | 40 to 60 μm |
---|---|
Type | Solid Phase Extraction Well Plate |
Volume (Metric) Well | 1 mL |
Sorbent | HyperSep Aminopropyl |
For Use With (Application) | Extraction of Strong Acids via Polar and Anion Exchange Interactions |
Product Line | HyperSep |
Thermo Scientific™ HyperSep™ Verify CX Plates
Get improved analysis of drugs of abuse, including basic and neutral drugs, with these SPE well plates featuring both nonpolar and ionic separation characteristics.
Particle Size | 40 to 60 μm |
---|---|
Type | Solid Phase Extraction Well Plate |
Volume (Metric) Well | 1 mL |
Sorbent | HyperSep Reversed Phase C8/Benzene Sulfonic Acid Ion Exchanger |
For Use With (Application) | Analysis of Drugs of Abuse |
Product Line | HyperSep |
Honeywell Fluka™ 96 Deep Well Plates with Strong Anion Exchange (Aminopropyl)
96 Well Plate with 100mg Strong Anion Exchange (Aminopropyl)
MilliporeSigma™ HybridSPE™-PL Cartridge
HybridSPE™ Phospholipid Removal Technology for Biological Matrices. Remove phospholipids and proteins for accurate and reproducible LC-MS analysis.
MilliporeSigma™ HybridSPE™-Phospholipid Ultra Cartridge
HybridSPE™ Phospholipid Removal Technology for Biological Matrices. Remove phospholipids and proteins for accurate and reproducible LC-MS analysis.
Thermo Scientific™ HyperSep™ SAX Plates
Obtain excellent performance for extraction of carboxylic and other weak acids with these strong anion exchanger SPE well plates and individual wells.
Particle Size | 40 to 60 μm |
---|---|
Type | 96-well Plate |
Volume (Metric) Well | 1 mL |
Sorbent | HyperSep SAX |
For Use With (Application) | Extraction of Weak Acids |
Product Line | HyperSep |
Thermo Scientific™ Hypersep™ Hypercarb™ Fixed Well Plate
Unique material for retention of highly polar compounds.
Particle Size | 40 to 60 μm |
---|---|
Type | 96-well Plate |
For Use With (Equipment) | Universal Vacuum Manifold |
Quantity | 1/Ea |
Sorbent | HypeSep Hypercarb |
Product Line | HyperSep |
Invitrogen™ Human PGC (aa 21-81) Control Fragment Recombinant Protein
Recombinant Protein

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | VPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMDAAYFGEISIGT |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human PGC (aa 21-81) Control Fragment |
Recombinant | Recombinant |
Waters Corp 96-Flangeless SPE Cartridge Holder;
96-Flangeless SPE Cartridge Holder;

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Revvity Health Sciences Inc Servo-Tray Reusable Vial Carriers
Servo-Tray Reusable Vial Carriers

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
SILICYCLE SILIASEP OT SCX 60ML10G PK16
SILIASEP OT SCX 60ML10G PK16

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
BIOLEGEND PE/CYANINE5 ANTI-HUMAN/MOUSE/R
50-272-2396 PE/CYANINE5 ANTI-HUMAN/MOUSE/R

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More