Antibiotics

Compounds and substances that kill or slow the growth of bacteria; used as a means of preventing bacterial contamination in cell cultures; various formulations and volumes available.

Search Within Results

1,741 – 1,755 of 7,060 results

1,741

Cayman Chemical ANTIBODY RIfampIcIn 5g

A rifamycin antibiotic; inhibits bacterial RNA polymerase (IC50 = 0.01 μg/ml for the E. coli enzyme); inhibits the growth of M. tuberculosis H37Rv in mouse peritoneal macrophages (MIC = 0.8 μg/ml) as well as clinical isolates of various species of Staphylococcus, Streptococcus, Haemophilus, and Neisseria (MICs = 0.009-1.4 μg/ml); increases survival in a mouse model of tuberculosis infection; an agonist of the human PXR (EC50 = ~2 μM)

Pricing & Availability

1,742

Apexbio Technology LLC Salinomycin, 5mg. Cas: 53003-10-4 MFCD: MFCD00865281. Polyether ionophore antibiotic;anti-cancer

IC50: 7.7, 13.7 and 10.4 M for HepG2, SMMC-7721 and BEL-7402 cell line, respectively (after 24h treatment)Salinomycin (Sal), which is a polyether ionophore antibiotic from Streptomyces albus, has been proven to be able to kill different types of human cancer cells. Other sizes are available. Please inqury us for quote.

Pricing & Availability

1,743

eMolecules 195371-52-9 | Medchem Express | NSC 42834 | 5mg | 446265776 | HY-15480 | MFCD00023550 | 344.458 | C23H24N2O

ChemScene | 5-Chloro-3-phenylisoxazole | 100mg | 632297440 | CS-0156348 | 3356-89-6 | MFCD00046079 | 179.600 | C9H6ClNO

If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>

Pricing & Availability

1,744

Medchemexpress LLC HY-101856 10mg Medchemexpress, BMS-986142 CAS:1643368-58-4 Purity:>98%

Medchemexpress, HY-101856 10mg BMS-986142 CAS:1643368-58-4 BMS-986142 is a potent and highly selective reversible inhibitor of Bruton's tyrosine kinase (BTK) with an IC50 of 0.5 nM. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.

Pricing & Availability

1,745

Medchemexpress LLC HY-118628 25mg Medchemexpress, N-(p-amylcinnamoyl) Anthranilic Acid CAS:110683-10-8 Purity:>98%

Medchemexpress, HY-118628 25mg N-(p-amylcinnamoyl) Anthranilic Acid CAS:110683-10-8 N-(p-amylcinnamoyl) Anthranilic Acid (ACA) is a broad spectrum Phospholipase A 2 (PLA 2 ) inhibitor and TRP channel blocker [1] [2] . N-(p-amylcinnamoyl) Anthranilic Acid (ACA) is also an effective reversible inhibitor of calcium-activated chloride channels , has potential to treat arrhythmia [3] . Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.

Pricing & Availability

1,746

Medchemexpress LLC RADAFAXINE HYDROCHL | 5MG

RADAFAXINE HYDROCHL | 5MG

Pricing & Availability

1,747

Medchemexpress LLC HY-15222 5mg Medchemexpress, Menin-MLL inhibitor MI-2 CAS:1271738-62-5 Purity:>98%

Medchemexpress, HY-15222 5mg Menin-MLL inhibitor MI-2 CAS:1271738-62-5 Menin-MLL inhibitor MI-2 is a Menin-MLL interaction inhibitor with IC50 of 446±28 nM. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.

Pricing & Availability

1,748

Research Products International Corp Doxorubicin Hydrochloride, Powder, 10 Milligrams

Doxorubicin Hydrochloride is a potent chemotherapeutic agent. It intercalates with DNA, inhibiting nucleic acid synthesis, and also generates free radicals that cause DNA strand breaks. These actions disrupt the replication and transcription processes, leading to cell death. It also generates free radicals that can cause DNA damage and induce apoptosis (programmed cell death) in cancer cells.

Doxorubicin is widely used in cancer research as a tool to study cellular responses to DNA damage, apoptosis, and mechanisms of drug resistance.

WARNING! This product can expose you to Doxorubicin HCl, a chemical which is known to the State of California to cause developmental harm. For more information go to www.P65Warnings.ca.gov.

Pricing & Availability

1,749

Cayman Chemical RoxIthromycIn 10g

A macrolide antibiotic; active against five strains EAch of Staphylococcus and Streptococcus (geometric mean MICs = 0.08 and 0.79 UG/ml, respectively), as well as several strains EAch of Corynebacterium, Haemophilus, and S. pneumoniae (MIC50s = 0.02, 0.01, and 2.5 UG/ml, respectively); protective against infection by strains of S. aureus, S. pyogenes, S. pneumoniae, or L. monocytogenes in mice (PD50s = 23-98 mg/kg)

Pricing & Availability

1,750

CPC Scientific H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-OH (trifluoroacetate salt) 0.5MG

Peptide found to have anabolic effect on bone formation in rats that can inhibit the rapid decline in bone formation due to denervation.ONE-LETTER SEQUENCE: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAMOLECULAR FORMULA: C180H287N57O48MOLECULAR WEIGHT:4016.57STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [112955-31-4], RESEARCH AREA: OsteoporosisREFERENCES: L.J. Suva et al., Science, 237, 893 (1987)

Pricing & Availability

1,751

Medchemexpress LLC HY-19364 5mg Medchemexpress, Ferroquine CAS:185055-67-8 Purity:>98%

Medchemexpress, HY-19364 5mg Ferroquine CAS:185055-67-8 Ferroquine (Ferrochloroquine), a ferrocenyl analogue of Chloroquine, is an antimalarial agent. Ferroquine shows parasiticidal effect on Plasmodium by inducing oxidative stress and the subsequent destruction of the membrane. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.

Pricing & Availability

1,752

Sigma Aldrich Fine Chemicals Biosciences Cetylpyridinium chloride European Pharmacopoeia (EP) Reference Standard | 6004-24-6 | MFCD00149977 |

Cetylpyridinium chloride European Pharmacopoeia (EP) Reference Standard | Mol Wt: 358 | 6004-24-6 | MFCD00149977 |

Pricing & Availability

1,753

Alkali Scientific Clindamycin HCl, 5 G

Clindamycin HCl is a lincosamide antibiotic widely used in microbiology and biochemical research to inhibit bacterial protein synthesis. It acts by binding to the 50S ribosomal subunit, blocking peptide bond formation and preventing bacterial growth. This antibiotic is effective against a range of Gram-positive organisms and anaerobic bacteria, making it useful in selective culture conditions and antimicrobial assays. It is commonly utilized in laboratory studies investigating bacterial susceptibility, resistance patterns, and protein translation mechanisms. Clindamycin is suitable for in vitro applications, including cell culture systems and biochemical experiments focused on antibiotic activity and microbial physiology.

Pricing & Availability

1,754

Biotium MTS-ATFB 10MG

MTS-ATFB 10MG

Pricing & Availability

1,755

Biotium RUBP-4S 5MG

RUBP-4S 5MG

Pricing & Availability

Antibiotics

Filtered Search Results

Narrow Results

Medchemexpress LLC HY-101856 10mg Medchemexpress, BMS-986142 CAS:1643368-58-4 Purity:>98% Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Medchemexpress LLC HY-118628 25mg Medchemexpress, N-(p-amylcinnamoyl) Anthranilic Acid CAS:110683-10-8 Purity:>98% Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Medchemexpress LLC RADAFAXINE HYDROCHL | 5MG Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Medchemexpress LLC HY-15222 5mg Medchemexpress, Menin-MLL inhibitor MI-2 CAS:1271738-62-5 Purity:>98% Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Research Products International Corp Doxorubicin Hydrochloride, Powder, 10 Milligrams Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Medchemexpress LLC HY-19364 5mg Medchemexpress, Ferroquine CAS:185055-67-8 Purity:>98% Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More