Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

2,386 – 2,400 of 1,816,563 results

2,386

VSV Nucleoprotein Mouse anti-Virus, Clone: 10G4, MilliporeSigma™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Stable for 1 year at 2-8°C from date of receipt.
Target Species	Virus
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunocytochemistry,Immunoprecipitation,Western Blot
Form	Purified
Isotype	IgG2a κ
Antigen	VSV Nucleoprotein
Regulatory Status	RUO
Purification Method	Protein G purified
Formulation	Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Immunogen	Vesicular stomatitis virus, Indiana serotype.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	10G4

2,387

CD14 Mouse anti-Human, FITC, Clone: MΦP9, BD

Mouse Monoclonal Antibody

Pricing & Availability

2,388

PHF10 Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate	Unconjugated
Target Species	Human
Host Species	Rabbit
Applications	Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype	IgG
Antigen	PHF10
Regulatory Status	RUO
Purification Method	Affinity Purified
Gene Alias	BAF45a, BAF45APHD zinc finger protein XAP135, BRG1-associated factor 45a, FLJ10975, MGC111009, PHD finger protein 10, XAP135BRG1-associated factor, 45-KD, A
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	55274
Classification	Polyclonal
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: GRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKPKVI
Primary or Secondary	Primary

2,389

Human CD163 Alexa Fluor™ 488-conjugated Antibody, R&D Systems™

Mouse Monoclonal Antibody has been used in 2 publications

Pricing & Availability
Specifications

Content And Storage	Protect from light. Do not freeze. 12 months from date of receipt, 2 to 8 degreesC as supplied.
Target Species	Human
Host Species	Mouse
Conjugate	Alexa Fluor 488
Applications	Flow Cytometry
Form	Purified
Isotype	IgG1
Gene Accession No.	Q86VB7
Antigen	CD163
Gene Symbols	CD163
Regulatory Status	RUO
Purification Method	Protein A or G purified from hybridoma culture supernatant
Dilution	Flow Cytometry 5 uL/10^6 cells
Gene Alias	CD_antigen: CD163, CD163, CD163 molecule, GHI/61, HbSR, Hemoglobin scavenger receptor, M130, macrophage-associated antigen, MM130, RM3/1, SCARI1, scavenger receptor cysteine-rich type 1 protein M130, sCD163, Soluble CD163
Product Type	Antibody
Gene ID (Entrez)	9332
Formulation	Supplied in a saline solution containing BSA and Sodium Azide. with Sodium Azide
Immunogen	Mouse myeloma cell line NS0-derived recombinant human CD163 Gly46-Ser1050 Accession # Q86VB7
Classification	Monoclonal
Primary or Secondary	Primary
Test Specificity	Detects human CD163 in direct ELISAs and Western blots.
Clone	215927

2,390

CD64 Mouse anti-Human, APC, Clone: 10.1, BD

Mouse Monoclonal Antibody

Pricing & Availability

2,391

Human CD34 Antibody, R&D Systems™

Rabbit Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70°C as supplied. 1 month, 2°C to 8°C under sterile conditions after reconstitution. 6 months, -20°C to -70°C under sterile conditions after reconstitution.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunocytochemistry
Form	Purified
Isotype	IgG
Gene Accession No.	P28906
Antigen	CD34
Regulatory Status	RUO
Purification Method	Protein A or G purified from hybridoma culture supernatant
Dilution	Flow Cytometry 0.25 ug/10^6 cells, Immunocytochemistry 3-15 ug/mL
Gene Alias	CD34, CD34 antigenhematopoietic progenitor cell antigen CD34, CD34 molecule, HPCA1
Product Type	Antibody
Gene ID (Entrez)	947
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Immunogen	Chinese Hamster Ovary cell line, CHO-derived human CD34, Ser32-Thr290, Accession # P28906
Classification	Monoclonal
Reconstitution	Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary	Primary
Clone	2936H

2,392

IL-17RC Antibody (309822), DyLight 405, R&D Systems™

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Antigen	IL-17RC
Regulatory Status	RUO
Content And Storage	Store at 4°C in the dark.
Target Species	Human
Host Species	Mouse
Conjugate	DyLight 405
Applications	CyTOF,Flow Cytometry
Form	Purified
Gene ID (Entrez)	84818
Classification	Monoclonal
Immunogen	Mouse myeloma cell line NS0-derived recombinant human IL-17 RC, Leu21-Ala454, Accession # NP_116121
Primary or Secondary	Primary
Clone	309822

2,393

Ki-67 Mouse, Alexa Fluor 647, Clone: B56, BD

Mouse Monoclonal Antibody

Pricing & Availability

2,394

Ki-67 Monoclonal Antibody (SolA15), APC, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse,Rat,Canine,Monkey,Cynomolgus Monkey
Host Species	Rat
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	E9PVX6, P46013
Concentration	0.2 mg/mL
Antigen	Ki-67
Gene Symbols	Mki67
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	antigen identified by monoclonal antibody Ki 67; antigen identified by monoclonal antibody Ki-67; Antigen identified by monoclonal antibody Ki-67 homolog; Antigen KI-67; Antigen KI-67 homolog; antigen KI-67; proliferation marker protein Ki-67; antigen KI-67-like; cb31; D630048A14Rik; I79_022666; Ki67; Ki-67; KIA; LOW QUALITY PROTEIN: proliferation marker protein Ki-67; marker of proliferation Ki-67; MIB-; MIB-1; Mki67; PPP1R105; Proliferation marker protein Ki-67; proliferation-related Ki-67 antigen; protein phosphatase 1, regulatory subunit 105; RP11-380J17.2; sb:cb31; si:ch211-250b22.7; unnamed protein product; wu:fa11g09; wu:fb57a07; wu:fi14e05
Gene	Mki67
Product Type	Antibody
Gene ID (Entrez)	100686578, 102135895, 17345, 291234, 4288
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	SolA15

2,395

Invitrogen™ PLA2R1 Monoclonal Antibody (CL0485)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	Q13018
Isotype	IgG1
Concentration	1 mg/mL
Antigen	PLA2R1
Gene Symbols	Pla2r1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	180 kDa secretory phospholipase A2 receptor; CLEC13C; C-type lectin domain family 13 member C; mannose receptor, C type 2; Mrc2; M-type receptor; phospholipase A2 receptor 1; phospholipase A2 receptor 1, 180kD; phospholipase A2 receptor 1, 180kDa; phospholipase A2, group IB, pancreas, receptor; Pla2g1br; PLA2G1R; PLA2-I receptor; PLA2IR; Pla2r; Pla2-r; PLA2R1; Secretory phospholipase A2 receptor; Soluble PLA2-R; Soluble secretory phospholipase A2 receptor
Gene	Pla2r1
Product Type	Antibody
Gene ID (Entrez)	22925
Formulation	PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen	Recombinant protein fragment of Human PLA2R1 (Product #RP-90366)
Classification	Monoclonal
Primary or Secondary	Primary
Clone	CL0485

2,396

Invitrogen™ Insulin Recombinant Rabbit Monoclonal Antibody (19H4L12)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Immunocytochemistry
Form	Liquid
Gene Accession No.	P01308
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	Insulin
Gene Symbols	INS
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	AA986540; IDDM; IDDM1; IDDM2; ILPR; INS; Ins1; Ins-1; Ins2; Ins-2; Ins2-rs1; InsII; Insulin; insulin 1; insulin 2; Insulin A chain; Insulin B chain; insulin I; insulin II; insulin-1; Insulin-1 A chain; Insulin-1 B chain; Insulin-2; Insulin-2 A chain; Insulin-2 B chain; IRDN; Mody; MODY10; Mody4; preproinsulin; proinsulin
Gene	INS
Product Type	Antibody
Gene ID (Entrez)	3630
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Human insulin (aa 25-110).
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	19H4L12

2,397

Invitrogen™ I-Ab/I-Ad Monoclonal Antibody (25-9-17S), FITC

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. Store in the dark.
Target Species	Mouse
Host Species	Mouse
Conjugate	FITC
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P01921, P06342, P06343, P06344, P06345, P06346, P14483
Isotype	IgG2a
Concentration	0.1 mg/mL
Antigen	I-Ab/I-Ad
Gene Symbols	H2-Ab1
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	Abeta; AI845868; H-2 class II histocompatibility antigen, A beta chain; H-2Ab; H2-Ab; H2-Ab1; H2-iabeta; histocompatibility 2, class II antigen A, beta 1; Ia2; Ia-2; IAb; I-Abeta; major histocompatibility complex class II beta chain; MHC class II antigen A beta; MHC class II H2-IA-beta-psi; response to metastatic cancers 1; Rmcs1
Gene	H2-Ab1
Product Type	Antibody
Gene ID (Entrez)	14961
Formulation	PBS with 4-5mg/mL BSA and 0.02% sodium azide
Immunogen	C3H.SW splenocytes.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	25-9-17S

2,398

Coronavirus Mouse anti-Human, Clone: 541-8F, MilliporeSigma™

Mouse Monoclonal Antibody

Pricing & Availability

2,399

Fibroblast Activation Protein alpha/FAP Antibody (427819), PE/Cy5.5, R&D Systems™

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Antigen	Fibroblast Activation Protein alpha/FAP
Regulatory Status	RUO
Content And Storage	Store at 4C in the dark. Do not freeze.
Target Species	Human
Host Species	Mouse
Conjugate	PE-Cyanine5.5
Applications	Flow Cytometry
Form	Purified
Gene ID (Entrez)	2191
Classification	Monoclonal
Immunogen	S. frugiperda insect ovarian cell line Sf 21-derived recombinant human Fibroblast Activation Protein alpha/FAP, Leu26-Asp760, Accession # Q12884
Primary or Secondary	Primary
Clone	427819

2,400

ABL2 Antibody (2L9C6), R&D Systems™

A Novus product, part of R&D Systems. Rabbit Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Western Blot
Form	Purified
Isotype	IgG
Research Discipline	Protein Kinase
Antigen	ABL2
Regulatory Status	RUO
Purification Method	Affinity purified
Dilution	Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL
Gene Alias	Abelson murine leukemia viral (v-abl) oncogene homolog 2, Abelson murine leukemia viral oncogene homolog 2, Abelson-related gene protein, Abelson-relatedgene), arg tyrosine kinase, EC 2.7.10, EC 2.7.10.2, FLJ22224, FLJ31718, FLJ41441, tyrosine-protein kinase ABL2, Tyrosine-protein kinase ARG, v-abl Abelson murine leukemia viral oncogene homolog 2
Product Type	Antibody
Gene ID (Entrez)	27
Formulation	PBS (pH 7.3), 50% glycerol, 0.05% BSA
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ABL2 (P42684).,, Sequence:, KGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATE
Classification	Monoclonal
Primary or Secondary	Primary
Clone	2L9C6

Primary Antibodies

Filtered Search Results

Narrow Results

Human CD163 Alexa Fluor™ 488-conjugated Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Human CD34 Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PLA2R1 Monoclonal Antibody (CL0485) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ I-Ab/I-Ad Monoclonal Antibody (25-9-17S), FITC Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Human CD163 Alexa Fluor™ 488-conjugated Antibody, R&D Systems™

Human CD34 Antibody, R&D Systems™

Invitrogen™ PLA2R1 Monoclonal Antibody (CL0485)

Invitrogen™ I-Ab/I-Ad Monoclonal Antibody (25-9-17S), FITC