Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

3,391 – 3,405 of 1,824,686 results

3,391

CD19 Monoclonal Antibody (eBio1D3 (1D3)), Brilliant Ultra Violet™ 563, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Brilliant Ultraviolet 563
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P25918
Concentration	0.2 mg/mL
Antigen	CD19
Gene Symbols	Cd19
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AW495831; B4; B-lymphocyte antigen CD19; B-lymphocyte surface antigen B4; Cd19; CD19 antigen; CD19 molecule; CVID3; differentiation antigen CD19; Leu-12; T-cell surface antigen Leu-12
Gene	Cd19
Product Type	Antibody
Gene ID (Entrez)	12478
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	eBio1D3 (1D3)

3,392

Invitrogen™ SLC34A2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	O95436, Q9DBP0, Q9JJ09
Isotype	IgG
Concentration	500 μg/mL
Antigen	SLC34A2
Gene Symbols	SLC34A2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AA536683; D5Ertd227e; Na(+)/Pi cotransporter 2B; Na(+)-dependent phosphate cotransporter 2B; NAPI IIb; NaPi-2b; NaPi3b; NAPI-3B; NAPI-IIb; Npt2b; NPTIIb; rNaPi IIb; Slc34a2; Sodium/phosphate cotransporter 2B; Sodium-dependent phosphate transport protein 2B; sodium-phosphate transport protein 2B; solute carrier family 34 (sodium phosphate), member 2; solute carrier family 34 (type II sodium/phosphate contransporter), member 2; solute carrier family 34 (type II sodium/phosphate cotransporter), member 2; solute carrier family 34 member 2; type II sodium-dependent phosphate transporter 3b; type IIb Na/Picotransporter; type IIb sodium-phosphate transporter
Gene	SLC34A2
Product Type	Antibody
Gene ID (Entrez)	10568, 20531, 84395
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence of human SLC34A2 (QNWTMKNVTYKENIAKCQHIFVNFHLPDLA).
Classification	Polyclonal
Primary or Secondary	Primary

3,393

Invitrogen™ Perforin Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles, store in dark
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P14222
Isotype	IgG
Concentration	1 mg/mL
Antigen	Perforin
Gene Symbols	PRF1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Cyta; Cytolysin; FLH2; HPLH2; lymphocyte pore forming protein; lymphocyte pore-forming protein; OMAK; OTTHUMP00000019759; P1; perforin 1; perforin 1 (pore forming protein); Perforin1; perforin-1; Pfn; PFN1; Pfp; PGFL; PIGF; PIGF-2; PLGF; pore forming protein; pore-forming protein; PRF1; Prf-1; PRF1 (pore forming protein 1); RATCYTA; RP11-710A11.3
Gene	PRF1
Product Type	Antibody
Gene ID (Entrez)	5551
Formulation	PBS with 50% glycerol, 0.2% BSA and 0.05% sodium azide; pH 7.4
Immunogen	Recombinant protein within Human Perforin aa 306-515.
Classification	Polyclonal
Primary or Secondary	Primary

3,394

Invitrogen™ TLR7 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P58681, Q9NYK1
Isotype	IgG
Concentration	1.0 mg/mL
Antigen	TLR7
Gene Symbols	TLR7
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	RGD1563357; RP23-139P21.3; Tlr7; TLR7-like; toll like receptor 7; toll-like receptor 7; toll-like receptor 7-like; UNQ248/PRO285
Gene	TLR7
Product Type	Antibody
Gene ID (Entrez)	170743, 317468, 51284
Formulation	PBS with 0.05% sodium azide
Immunogen	KLH-conjugated synthetic peptide corresponding to amino acids 706-749 of human TLR7.
Classification	Polyclonal
Primary or Secondary	Primary

3,395

Invitrogen™ PLA2G4A Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P47712, P47713
Isotype	IgG
Concentration	0.3 mg/mL
Antigen	PLA2G4A
Gene Symbols	PLA2G4A
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	calcium-dependent phospholipid-binding protein; Cpla2; cPLA2alpha; cPLA2-alpha; cytosolic group IVA; Cytosolic phospholipase A2; group IVA; lysophospholipase; MGC126350; Phosphatidylcholine 2-acylhydrolase; Phospholipase A2; phospholipase A2 cytosolic; phospholipase A2 group IVA; phospholipase A2, group IVA (cytosolic, calcium-dependent); Pla2c; Pla2g4; PLA2G4A
Gene	PLA2G4A
Product Type	Antibody
Gene ID (Entrez)	18783, 5321
Formulation	PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the N-terminus region of human PLA2G4A. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

3,396

Invitrogen™ CD5 Monoclonal Antibody (UCHT2), eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Frozen),Western Blot
Form	Liquid
Gene Accession No.	P06127
Isotype	IgG1 κ
Concentration	0.5 mg/mL
Antigen	CD5
Gene Symbols	Cd5
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	alanyl (membrane) aminopeptidase; alanyl aminopeptidase; alanyl aminopeptidase, membrane; aminopeptidase M; Aminopeptidase N; ANPEP; AP-M; APN; AP-N; CD antigen CD5; CD13; CD28; CD28 antigen (Tp44); CD28 molecule; Cd5; CD5 antigen; CD5 antigen (p56 62); CD5 antigen (p56-62); CD5 antigen p56-62; CD5 molecule; CD5 protein; CD74 antigen, invariant polypeptide of major; cell surface protein; costimulatory molecule B7 receptor CD28; fCD5; GP150; hAPN; LAP1; LEU1; Ly-1; Ly12; Ly-12; LyA; Ly-A; Lymphocyte antigen 1; Lymphocyte antigen CD5; lymphocyte antigen T1/Leu-1; Lyt-1; membrane alanyl aminopeptidase; microsomal aminopeptidase; Myeloid plasma membrane glycoprotein CD13; P150; Pan T cell; PEPN; T1; T-cell costimulatory molecule CD28; T-cell surface glycoprotein CD5; T-cell-specific surface glycoprotein CD28; unnamed protein product
Gene	Cd5
Product Type	Antibody
Gene ID (Entrez)	921
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	UCHT2

3,397

Invitrogen™ CNR2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P34972, Q9QZN9
Isotype	IgG
Concentration	1 mg/mL
Antigen	CNR2
Gene Symbols	CNR2
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Cannabinoid Receptor 2; cannabinoid receptor 2 (macrophage); CB2; CB-2; CB2 receptor; CB2A; CB2B; CB2C; CB2R; CB2-R; CNR2; CNR2C; CNR3; CX5; HCB2; HGNC:2160; OTTHUMP00000044841; peripheral cannabinoid receptor; rCB2; RP11-4M23.1; testis-dominant CNR2 isoform CB2
Gene	CNR2
Product Type	Antibody
Gene ID (Entrez)	1269, 57302
Formulation	PBS with 1mg/mL BSA, 50% glycerol and 0.05% sodium azide
Immunogen	GST fusion protein containing the first 32 amino acid residues from Rat CB2.
Classification	Polyclonal
Primary or Secondary	Primary

3,398

Invitrogen™ Calretinin Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P22676, P47728, Q08331
Isotype	IgG
Concentration	0.64 mg/mL
Antigen	Calretinin
Gene Symbols	CALB2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	29 kDa calbindin; 29kD calretinin; 29kDa calbindin; CAB29; CAL2; Calb2; calbindin 2; calbindin 2, (29kD, calretinin); calbindin 2, 29kDa; calbindin D29K; calretinin; CR; testicular secretory protein Li 8
Gene	CALB2
Product Type	Antibody
Gene ID (Entrez)	117059, 12308, 794
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human Calretinin. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

3,399

TCR gamma/delta Monoclonal Antibody (eBioGL3 (GL-3, GL3)), FITC, eBioscience™, Invitrogen™

Armenian Hamster Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Armenian Hamster
Conjugate	FITC
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG
Gene Accession No.	0
Concentration	0.5 mg/mL
Antigen	TCR gamma/delta
Gene Symbols	Tcrd, Tcrg
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	RGD1311300; similar to T cell receptor V delta 6; T cell receptor gamma locus; T3/TCR complex; TCR delta gamma; TCR gamma/delta; TCR-CD3 complex; Tcrg; Trg; Trg@
Product Type	Antibody
Gene ID (Entrez)	110066, 110067
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	eBioGL3 (GL-3, GL3),GL3)

3,400

HLA-ABC Monoclonal Antibody (W6/32), Brilliant Violet™ 786, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Violet 786
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P01889, P04439, P10321
Concentration	5 μL/Test
Antigen	HLA-ABC
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	A29 protein; alpha chain of MHC class II; antigen presenting molecule; AS; Aw-33; Aw-74; B-4901; B-5001; Bw-47; Bw-50; class I MHC, HLA-B antigen; D6S204; epididymis secretory protein Li 83; H-2K; H2-K; H-2K(d); HEL-S-83; histocompatibility antigen; HLA A; HLA -B; HLA B-40011; HLA B44; HLA C; HLA class I antigen; HLA class I antigen HLA-B; HLA class I histocompatibility antigen C alpha chain; HLA class I histocompatibility antigen Cw-1 alpha chain; HLA class I histocompatibility antigen, A alpha chain; HLA class I histocompatibility antigen, A-1 alpha chain; HLA class I histocompatibility antigen, A-11 alpha chain-like; HLA class I histocompatibility antigen, A-30 alpha chain; HLA class I histocompatibility antigen, A-33 alpha chain; HLA class I histocompatibility antigen, A-74 alpha chain; HLA class I histocompatibility antigen, B alpha chain; HLA class I histocompatibility antigen, B-47 alpha chain; HLA class I histocompatibility antigen, B-50 alpha chain; HLA class I histocompatibility antigen, B-82 alpha chain; HLA class I histocompatibility antigen, C alpha chain; HLA class I histocompatibility antigen, Cw-1 alpha chain; HLA class I histocompatibility antigen, Cw-15 alpha chain; HLA class I histocompatibility antigen, Cw-18 alpha chain; HLA locus; HLA molecule; HLAA; HLA-A; HLA-A locus alpha 2 domain; HLA-A null; HLA-A11; HLA-A33; HLA-Aw33.1; HLAB; HLA-B; HLA-B 1502; HLA-B alpha chain; HLA-B alpha chain (B2706); HLA-B alpha chain (B5002); HLA-B alpha-chain; HLA-B45ZJ; HLA-B15; HLA-B35; HLA-B35 antigen; HLA-B-3506; HLA-B39; HLA-B-3905; HLA-B49; HLA-B50; HLA-B55; HLA-B-5502; HLA-B-5602; HLA-B59; HLA-B61; HLA-Bw50 antigen; HLAC; HLA-C; HLA-C alpha chain; HLA-C alpha chain (HLA-Cw15v); HLA-C alpha chain for Cw18GB; HLA-C alpha-chain; HLA-C antigen; HLA-Cw; HLA-Cw04GB; HLA-Cw1702; HLA-Cw18GB; HLA-Cw-1503; HLA-DQB1; HLA-DRB1; HLA-JY3; HLC-C; Human leukocyte antigen A; Human leukocyte antigen C; human leukocyte antigen-C alpha chain; hypothetical protein; lecocyte antigen B; leucocyte antigen A; Leukocyte Antigen; leukocyte antigen C; leukocyte antigen class I-A; leukocyte antigen class I-B; Leukoocyte Antigen; LOC100515902; LOW QUALITY PROTEIN: HLA class I histocompatibility antigen, A-11 alpha chain-like; lymphocyte antigen; major histocompatability complex B antigen; major histocompatibility antigen HLA-C; major histocompatibility complex, class I, A; major histocompatibility complex, class I, B; major histocompatibility complex, class I, C; MCH class I antigen; MGC184092; MGC7052; MHC; MHC 1; MHC antigen; MHC clas I antigen; MHC Class 1; MHC class 1 antigen; MHC class I; MHC class I alpha chain; MHC class I anitgen; MHC class I anti; MHC Class I antigen; MHC class I antigen A30; MHC class I antigen A33; MHC class I antigen A74; MHC class I antigen B47; MHC class I antigen B50; MHC class I antigen B82; MHC class I antigen Cw15; MHC class I antigen Cw18; MHC class I antigen GN00104; MHC class I antigen heavy chain; MHC class I antigen heavy chain HLA-C; MHC class I antigen HLA-A heavy chain; MHC class I antigen HLA-A33; MHC class I antigen HLA-B alpha chain; MHC class I antigen HLA-B heavy chain; MHC class I antigen null protein; MHC class I antigen SHCHA; MHC class I antigene; MHC class I histocompatibility antigen; MHC class I human leukocyte antigen; MHC class I molecule; MHC class I protein; MHC class II antigen; MHC class l antigen; MHC classI antigen; MHC HLA-ABC; MHC HLA-B cell surface glycoprotein; MHC HLA-B transmembrane glycoprotein; MHC HLA-B27d; MHC HLA-B27-HS; MHC HLA-B39N; MHC I HLA; MHC1; PSORS1; SPDA1; surface antigen; truncated class I antigen; truncated MHC class I antigen
Product Type	Antibody
Gene ID (Entrez)	3105, 3106, 3107
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	W6/32

3,401

Invitrogen™ CNR2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P34972
Isotype	IgG
Concentration	1 mg/mL
Antigen	CNR2
Gene Symbols	CNR2
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Cannabinoid Receptor 2; cannabinoid receptor 2 (macrophage); CB2; CB-2; CB2 receptor; CB2A; CB2B; CB2C; CB2R; CB2-R; CNR2; CNR2C; CNR3; CX5; HCB2; HGNC:2160; OTTHUMP00000044841; peripheral cannabinoid receptor; rCB2; RP11-4M23.1; testis-dominant CNR2 isoform CB2
Gene	CNR2
Product Type	Antibody
Gene ID (Entrez)	1269
Formulation	PBS with 1mg/mL BSA, 50% glycerol and 0.05% sodium azide
Immunogen	A fusion protein containing the first 33 amino acid residues from human CB2.
Classification	Polyclonal
Primary or Secondary	Primary

3,402

Invitrogen™ Gata-3 Monoclonal Antibody (TWAJ), Brilliant Violet™ 711, eBioscience™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse,Pig,Rhesus Macaque
Host Species	Rat
Conjugate	Brilliant Violet 711
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P23771, P23772
Isotype	IgG2b κ
Concentration	5 μL/Test
Antigen	Gata-3
Gene Symbols	GATA3
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	EGK_19445; GATA binding factor-3; GATA binding protein 3; GATA binding protein-3; GATA3; Gata-3; GATA-binding factor 3; GATA-binding protein 3; HDR; HDRS; jal; MGC2346; MGC5199; MGC5445; Trans-acting T-cell-specific transcription factor GATA-3; Transacting T-cell-specific transcription factor GATA-3
Gene	GATA3
Product Type	Antibody
Gene ID (Entrez)	14462, 2625, 713840, 733631
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	TWAJ

3,403

Invitrogen™ TDP-43 Monoclonal Antibody (3H8)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat,Bovine,Pig,Horse
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (PFA fixed),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q13148, Q921F2
Isotype	IgG1 κ
Concentration	1 mg/mL
Antigen	TDP-43
Gene Symbols	TARDBP
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	1190002A23Rik; ALS10; C85084; hypothetical protein; OTTHUMP00000002171; OTTHUMP00000002173; RCJMB04_5g9; RP4-635E18.2; TAR DNA binding protein; TAR DNA binding protein L homeolog; TAR DNA-binding protein 43; TAR DNA-binding protein-43; tardbp; tardbp.L; Tdp43; TDP-43; wu:fb77f02; wu:fc52g10; XELAEV_18035188mg
Gene	TARDBP
Product Type	Antibody
Gene ID (Entrez)	100051482, 100739753, 230908, 23435, 298648, 540632
Formulation	PBS with 50% glycerol and 5mM sodium azide
Immunogen	Full length recombinant human TDP43 expressed in and purified from E. coli.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	3H8

3,404

Invitrogen™ CD8a Monoclonal Antibody (RPA-T8), eFluor™ 506, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	eFluor 506
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P01732, P10966
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	CD8a
Gene Symbols	Cd8a, CD8B
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	BB154331; CD8; CD8 alpha; CD8 alpha chain; CD8 alpha chain precursor; CD8 antigen; CD8 antigen 32 kDa chain; CD8 antigen 37 kDa chain; CD8 antigen alpha polypeptide; CD8 antigen alpha protein; CD8 antigen alpha protein precursor; CD8 antigen alpha-chain; CD8 antigen beta polypeptide; CD8 antigen beta polypeptide precursor; CD8 antigen beta-chain; CD8 antigen, alpha chain; CD8 antigen, alpha polypeptide; CD8 antigen, alpha polypeptide (p32); CD8 antigen, alpha-chain; CD8 antigen, beta chain; CD8 antigen, beta chain 1; CD8 antigen, beta polypeptide; CD8 antigen, beta polypeptide 1 (p37); CD8 antigen, beta-chain; CD8 beta; CD8 beta chain; CD8 beta-2; CD8a; CD8A antigen alpha; CD8a molecule; CD8A; T-cell surface glycoprotein; CD8alpha; CD8B; CD8b antigen; CD8b molecule; CD8b molecule pseudogene; Cd8b1; CD8beta; CD8BP; fCD8; LEU2; Leu-2; Leu2 T-lymphocyte antigen; leu-2a; Ly-2; LY3; Ly-3; Ly-35; Ly-B; Ly-C; Lymphocyte antigen 3; Lyt2; Lyt-2; Lyt-2.1 lymphocyte differentiation antigen (AA at 100); Lyt3; Lyt-3; MAL; membrane glycoprotein; membrane protein; OKT8 T-cell antigen; OX-8 membrane antigen; p32; P37; RHACD8-4; T cell co-receptor; T lymphocyte surface glycoprotein beta chain; T8 T-cell antigen; T-cell antigen Leu2; T-cell membrane glycoprotein Ly-3; T-cell surface glycoprotein; T-cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 beta chain; T-cell surface glycoprotein Lyt-2; T-cell surface glycoprotein Lyt-3; T-cell surface molecule; T-lymphocyte differentiation antigen T8/Leu-2; type I transmembrane glycoprotein
Gene	Cd8a
Product Type	Antibody
Gene ID (Entrez)	925, 926
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	RPA-T8

3,405

CD157 Monoclonal Antibody (eBioSY11B5 (SY11B5)), PE, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	Q10588
Concentration	5 μL/Test
Antigen	CD157
Gene Symbols	Bst1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	114/A10; A530073F09; ADP-ribosyl cyclase 2; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2; antigen BP3; Bone marrow stromal antigen 1; bone marrow stromal cell antigen 1; Bp3; Bp-3; BP-3 alloantigen; Bst1; BST-1; Bsta1; cADPr hydrolase 2; CD157; CD157 antigen; Cyclic ADP-ribose hydrolase 2; leukocyte antigen 65; Ly65; Ly-65; NAD(+) nucleosidase; NAD+ nucleosidase
Gene	Bst1
Product Type	Antibody
Gene ID (Entrez)	683
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	eBioSY11B5 (SY11B5)

Primary Antibodies

Filtered Search Results

Narrow Results

CD19 Monoclonal Antibody (eBio1D3 (1D3)), Brilliant Ultra Violet™ 563, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SLC34A2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Perforin Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TLR7 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PLA2G4A Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD5 Monoclonal Antibody (UCHT2), eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CNR2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Calretinin Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

TCR gamma/delta Monoclonal Antibody (eBioGL3 (GL-3, GL3)), FITC, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

HLA-ABC Monoclonal Antibody (W6/32), Brilliant Violet™ 786, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CNR2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Gata-3 Monoclonal Antibody (TWAJ), Brilliant Violet™ 711, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TDP-43 Monoclonal Antibody (3H8) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD8a Monoclonal Antibody (RPA-T8), eFluor™ 506, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD157 Monoclonal Antibody (eBioSY11B5 (SY11B5)), PE, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD19 Monoclonal Antibody (eBio1D3 (1D3)), Brilliant Ultra Violet™ 563, eBioscience™, Invitrogen™

Invitrogen™ SLC34A2 Polyclonal Antibody

Invitrogen™ Perforin Polyclonal Antibody

Invitrogen™ TLR7 Polyclonal Antibody

Invitrogen™ PLA2G4A Polyclonal Antibody

Invitrogen™ CD5 Monoclonal Antibody (UCHT2), eBioscience™

Invitrogen™ CNR2 Polyclonal Antibody

Invitrogen™ Calretinin Polyclonal Antibody

TCR gamma/delta Monoclonal Antibody (eBioGL3 (GL-3, GL3)), FITC, eBioscience™, Invitrogen™

HLA-ABC Monoclonal Antibody (W6/32), Brilliant Violet™ 786, eBioscience™, Invitrogen™

Invitrogen™ CNR2 Polyclonal Antibody

Invitrogen™ Gata-3 Monoclonal Antibody (TWAJ), Brilliant Violet™ 711, eBioscience™

Invitrogen™ TDP-43 Monoclonal Antibody (3H8)

Invitrogen™ CD8a Monoclonal Antibody (RPA-T8), eFluor™ 506, eBioscience™

CD157 Monoclonal Antibody (eBioSY11B5 (SY11B5)), PE, eBioscience™, Invitrogen™