Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

3,631 – 3,645 of 1,824,522 results

3,631

Invitrogen™ CD59 (Protectin) Recombinant Rabbit Monoclonal Antibody (JM10-71)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunoprecipitation,Western Blot,Immunoprecipitation,Western Blot,Western Blot
Form	Liquid
Gene Accession No.	O55186, P13987, P58019
Isotype	IgG
Concentration	1 mg/mL
Antigen	CD59 (Protectin)
Gene Symbols	CD59, Cd59a, Cd59b
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	16.3A5; 1F5; 1F5 antigen; 20 kDa homologous restriction factor; AA987121; Cb59b molecule; CD59; CD59 antigen; CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344); CD59 glycoprotein; CD59 molecule; CD59 molecule (CD59 blood group); CD59 molecule, complement regulatory protein; Cd59a; CD59a antigen; CD59A glycoprotein; Cd59b; CD59b antigen; CD59B glycoprotein; CD59b moleucle, complement regulatory protein; complement inhibitor CD59; complement regulatory protein; EJ16; EJ30; EL32; G344; HRF20; HRF-20; human leukocyte antigen MIC11; Ly-6-like protein; lymphocytic antigen CD59/MEM43; MACIF; MAC-inhibitory protein; MACIP; MAC-IP; MEM43; MEM43 antigen; membrane attack complex (MAC) inhibition factor; membrane attack complex inhibition factor; Membrane inhibitor of reactive lysis; MIC11; MIN1; MIN2; MIN3; MIRL; MSK21; p18-20; protectin; surface anitgen recognized by monoclonal antibody 16.3A5; T cell-activating protein
Gene	CD59
Product Type	Antibody
Gene ID (Entrez)	12509, 333883, 966
Formulation	TBS with 0.05% BSA, 40% Glycerol and 0.05% sodium azide; pH 7.4
Immunogen	Synthetic peptide within Human CD59 aa 85-121.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	JM10-71

3,632

Invitrogen™ ULK1 Recombinant Rabbit Monoclonal Antibody (JA58-36)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O70405, O75385
Isotype	IgG
Concentration	1 mg/mL
Antigen	ULK1
Gene Symbols	ULK1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	APG1; ATG 1; ATG1; ATG1 autophagy related 1 homolog; ATG1A; AU041434; Autophagy-related protein 1 homolog; C. elegans; EC:2.7.11.1; FLJ38455; hATG1; KIAA0722; mKIAA0722; Serine/threonine-protein kinase ULK1; serine/threonine-protein kinase Unc51.1; ULK 1; Ulk1; UNC 51; UNC51; unc-51 like autophagy activating kinase 1; unc-51 like kinase 1; Unc51.1; unc-51-like kinase 1
Gene	ULK1
Product Type	Antibody
Gene ID (Entrez)	22241, 360827, 8408
Formulation	TBS with 0.05% BSA, 40% Glycerol and 0.05% sodium azide; pH 7.4
Immunogen	Synthetic peptide within Human ULK1 aa 930-979.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	JA58-36

3,633

Invitrogen™ CD31 (PECAM-1) Recombinant Rabbit Monoclonal Antibody (7O7K3)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P16284, Q08481, Q3SWT0
Isotype	IgG
Concentration	1 mg/mL
Antigen	CD31 (PECAM-1)
Gene Symbols	Pecam1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	C85791; CD31; CD31 antigen; CD31, PECAM-1; CD31/EndoCAM; endoCAM; GPIIA'; I79_008304; PECA1; Pecam; PECAM1; Pecam-1; platelet and endothelial cell adhesion molecule 1; platelet endothelial cell adhesion molecule; platelet endothelial cell adhesion molecule-1; platelet/endothelial cell adhesion molecule (CD31 antigen); platelet/endothelial cell adhesion molecule 1; type I transmembrane endothelial adhesion molecule
Gene	Pecam1
Product Type	Antibody
Gene ID (Entrez)	18613, 29583, 5175
Formulation	PBS with 50% glycerol, 0.05% BSA and 0.09% sodium azide; pH 7.3
Immunogen	Recombinant protein (or fragment).
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	7O7K3

3,634

Invitrogen™ CD16 Recombinant Rabbit Monoclonal Antibody (JE49-79)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	A0A0B4J1G0, O75015, P08508, P08637, Q6XPU4
Isotype	IgG
Concentration	1 mg/mL
Antigen	CD16
Gene Symbols	Fcgr3, FCGR3A, FCGR3B, Fcgr4
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	4833442P21Rik; CD16; CD16-2; CD16A; CD16a antigen; CD16b; CD32; CD32 receptor 2; CDw32; cytolytic trigger molecule G7; Fc fragment of IgG intermediate affinity IV receptor; Fc fragment of IgG low affinity IIIa receptor; Fc fragment of IgG receptor IIIa; Fc fragment of IgG receptor IIIb; Fc fragment of IgG, low affinity III, receptor for (CD16); Fc fragment of IgG, low affinity IIIa, receptor; Fc fragment of IgG, low affinity IIIa, receptor (CD16a); Fc fragment of IgG, low affinity IIIa, receptor for (CD16); Fc fragment of IgG, low affinity IIIa, receptor for (CD16); Fc fragment of IgG, low affinity III, receptor for (CD16); Fc fragment of IgG, low affinity IIIb, receptor (CD16b); Fc gamma receptor III; Fc gamma receptor IIIa; Fc gamma receptor III-A; Fc gamma receptor IIIb; Fc gamma RIIIa; Fc gammaRIV; Fc receptor, IgG, low affinity III; Fc receptor, IgG, low affinity IV; Fc receptor-like 3; Fcg receptor III; FCG2; FCG3; Fc-gamma receptor III-2 (CD 16); Fc-gamma receptor IIIb (CD 16); Fc-gamma receptor IIIb (CD16); Fc-gamma RII-b; Fc-gamma RII-c; fc-gamma RIII; Fc-gamma RIIIa; Fc-gamma RIII-alpha; fc-gamma RIIIb; fc-gamma RIII-beta; Fc-gamma-RIIb; Fc-gamma-RIIc; FcgammaRIII; FcgammaRIII a.1; FcgammaRIII a.2; FcgammaRIII a.3; FcgammaRIIIA; FcgammaRIV; FCGR2; FCGR2A; FCGR2B; FCGR2C; FCGR3; Fcgr3a; FCGR3B; Fcgr4; FCGRIII; FcgRIV; FcR-10; FcRII-b; FcRII-c; FcRIII; FCRIIIA; FCRIIIb; Fcrl3; IGFR3; IgG Fc gamma receptor III; igG Fc receptor III; IgG Fc receptor III-1; igG Fc receptor III-2; IMD20; immunoglobulin G Fc receptor III; LOC100911825; Low affinity immunoglobulin gamma Fc region receptor III; low affinity immunoglobulin gamma Fc region receptor III-A; Low affinity immunoglobulin gamma Fc region receptor III-B; low affinity immunoglobulin gamma Fc region receptor III-like; Low affinity immunoglobulin gamma Fc region receptor IV; neutrophil-specific antigen NA; RP11-5K23.1; transmembrane receptor FcgammaRIII-X
Gene	FCGR3A
Product Type	Antibody
Gene ID (Entrez)	14131, 2214, 2215, 246256, 304966
Formulation	TBS with 0.05% BSA, 40% glycerol and 0.05% sodium azide; pH 7.4
Immunogen	Recombinant protein within Human CD16 aa 151-254.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	JE49-79

3,635

Invitrogen™ Ferroportin Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q9NP59
Isotype	IgG
Concentration	0.40 mg/mL
Antigen	Ferroportin
Gene Symbols	SLC40A1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	CAR1; Cell adhesion regulator; duodenal-specific; Dusg; Ferroportin; ferroportin 1; ferroportin-1; Fpn1; Fpt1; HFE4; IREG1; iron regulated gene 1; iron-regulated transporter 1; Metal transporter protein 1; metal transporting protein 1; MST079; MSTP079; MTP; MTP1; Ol5; Pcm; polycythaemia; Slc11a3; SLC11A3 iron transporter; Slc39a1; Slc40a1; solute carrier family 11 (proton-coupled divalent metal ion transporters), member 3; solute carrier family 39 (iron-regulated transporter), member 1; solute carrier family 40 (iron-regulated transporter), member 1; solute carrier family 40 member 1
Gene	SLC40A1
Product Type	Antibody
Gene ID (Entrez)	30061
Formulation	PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen	Recombinant protein corresponding to Human SLC40A1. Recombinant protein control fragment (Product #RP-104220).
Classification	Polyclonal
Primary or Secondary	Primary

3,636

Invitrogen™ BSND Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin)
Form	Liquid
Gene Accession No.	Q8WZ55
Isotype	IgG
Concentration	0.3 mg/mL
Antigen	BSND
Gene Symbols	BSND
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	BART; Bartter syndrome, infantile, with sensorineural deafness (Barttin); barttin; barttin CLCNK type accessory beta subunit; barttin CLCNK-type chloride channel accessory beta subunit; Bsnd; deafness, autosomal recessive 73; DFNB73
Gene	BSND
Product Type	Antibody
Gene ID (Entrez)	7809
Formulation	PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen	Recombinant protein corresponding to Human BSND. Recombinant protein control fragment (Product #RP-98526).
Classification	Polyclonal
Primary or Secondary	Primary

3,637

IRF8 Monoclonal Antibody (V3GYWCH), Alexa Fluor™ 488, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	Alexa Fluor 488
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P23611, Q02556
Concentration	0.5 mg/mL
Antigen	IRF8
Gene Symbols	Irf8
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI893568; H-ICSBP; Icsbp; Icsbp1; IMD32A; IMD32B; interferon consensus sequence binding protein 1; Interferon consensus sequence-binding protein; Interferon regulatory factor 8; Irf8; IRF-8; Myls; transcription factor ICSBP
Gene	Irf8
Product Type	Antibody
Gene ID (Entrez)	15900, 3394
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	V3GYWCH

3,638

Invitrogen™ SFTPC Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P11685, P11686, P21841
Isotype	IgG
Concentration	0.45 mg/mL
Antigen	SFTPC
Gene Symbols	Sftpc
Regulatory Status	RUO
Purification Method	Protein A, Antigen affinity chromatography
Gene Alias	BRICD6; BRICHOS domain containing 6; LOW QUALITY PROTEIN: pulmonary surfactant-associated protein C; pro-SpC; PSP C; PSP-C; pulmonary surfactant apoprotein-2 SP-C; pulmonary surfactant associated protein C; pulmonary surfactant protein C; pulmonary surfactant-associated protein C; Pulmonary surfactant-associated proteolipid SPL(Val); SFTP 2; SFTP2; Sftp-2; Sftpc; SMDP2; SP C; SP5; SPC; SP-C; surfactant associated protein C; surfactant protein C; Surfactant pulmonary-associated protein C; Surfactant, pulmonary-associated protein C; surfactant-associated protein; type I SP-C; type I surfactant protein C; type II SP-C; type II surfactant protein C
Gene	Sftpc
Product Type	Antibody
Gene ID (Entrez)	20389, 50683, 6440
Formulation	PBS with 0.09% sodium azide; pH 7.4
Immunogen	KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human SFTPC.
Classification	Polyclonal
Primary or Secondary	Primary

3,639

Invitrogen™ CD23 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Immunocytochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P06734, P20693
Isotype	IgG
Concentration	500 μg/mL
Antigen	CD23
Gene Symbols	FCER2, Fcer2a
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	BLAST-2; CD23; CD23 antigen; CD23A; CLEC4J; C-type lectin domain family 4 member J; C-type lectin domain family 4, member J; Fc epsilon receptor II; FC epsilon RII; Fc fragment of IgE receptor II; Fc fragment of IgE, low affinity II, receptor for (CD23); Fc receptor alpha multiple ligand receptor; Fc receptor, IgE, low affinity II, alpha polypeptide; Fcalpha muR; Fcalpha RII; Fce2; fc-epsilon-RII; FCER2; Fcer2a; FceRII; IGEBF; Immunoglobulin E-binding factor; immunoglobulin epsilon-chain; low affinity immunoglobulin epsilon Fc receptor; Low affinity immunoglobulin epsilon Fc receptor membrane-bound form; Low affinity immunoglobulin epsilon Fc receptor soluble form; low-affinity IgE receptor; Ly-42; lymphocyte IgE receptor
Gene	FCER2
Product Type	Antibody
Gene ID (Entrez)	14128, 171075, 2208
Formulation	PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen	E.coli-derived mouse CD23 recombinant protein (Position: E50-P331).
Classification	Polyclonal
Primary or Secondary	Primary

3,640

ID2 Monoclonal Antibody (ILCID2), APC, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P41136, Q02363
Concentration	0.2 mg/mL
Antigen	ID2
Gene Symbols	ID2
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Ac2-300; AI255428; bHLHb26; C78922; cell growth-inhibiting gene 8; class B basic helix-loop-helix protein 26; DNA-binding protein inhibitor ID2; DNA-binding protein inhibitor ID-2; GIG8; helix-loop-helix protein ID2; Id2; Id-2; ID2A; ID2H; Idb2; Inhibitor of differentiation 2; inhibitor of DNA binding 2; inhibitor of DNA binding 2, dominant negative helix-loop-helix protein; inhibitor of DNA binding 2, HLH protein; MGC26389; OTTHUMP00000140258; OTTHUMP00000200297
Gene	ID2
Product Type	Antibody
Gene ID (Entrez)	15902, 3398
Formulation	PBS with 0.09% sodium azide; pH 7.2
Immunogen	Purified recombinant fragment of human ID2, corresponding to amino acids 1-134 expressed in E. coli.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	ILCID2

3,641

Invitrogen™ BIK Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunocytochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	O70337, Q13323
Isotype	IgG
Concentration	500 μg/mL
Antigen	BIK
Gene Symbols	BIK
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	apoptosis inducer NBK; apoptosis-inducing NBK; BBC1; BCL2 interacting killer; bcl-2-interacting killer; BCL2-interacting killer; BCL2-interacting killer (apoptosis-inducing); bhikhari; BIK; Bik-like killer protein; Biklk; BIP 1; BIP1; Blk; BP 4; BP4; cb 60; natural born killer; NBK
Gene	BIK
Product Type	Antibody
Gene ID (Entrez)	114496, 12124, 638
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	E.coli-derived human Bik recombinant protein (Position: M1-R123).
Classification	Polyclonal
Primary or Secondary	Primary

3,642

Invitrogen™ CD55 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunocytochemistry,Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P08174
Isotype	IgG
Concentration	500 μg/mL
Antigen	CD55
Gene Symbols	CD55
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	CD55; CD55 antigen; CD55 molecule (Cromer blood group); CD55 molecule, decay accelerating factor for complement; CD55 molecule, decay accelerating factor for complement (Cromer blood group); Cd55a; Complement decay-accelerating factor; complement decay-accelerating factor, GPI-anchored; complement-glycosylphosphatidylinositol; CR; CROM; Cromer blood group; Daf; Daf1; DAF-GPI; decay accelarating factor 1; decay accelerating factor 1; decay accelerating factor GPI-form; decay-accelarating factor; glycosylphophatidylinositol-anchored form; GPI anchor addition signal; GPI-DAF; RP11-357P18.1; TC
Gene	CD55
Product Type	Antibody
Gene ID (Entrez)	1604
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	E.coli-derived human CD55 recombinant protein (Position: D35-K347).
Classification	Polyclonal
Primary or Secondary	Primary

3,643

Invitrogen™ CYP27B1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	O15528, O35084, O35132
Isotype	IgG
Concentration	500 μg/mL
Antigen	CYP27B1
Gene Symbols	CYP27B1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	1alpha(OH)ase; 25 hydroxyvitamin D3-1-alpha hydroxylase; 25(OH)D 1alpha-hydroxylase; 25-hydroxyvitamin D(3) 1-alpha-hydroxylase; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial precursor (25-OHD-1 alpha-hydroxylase) (25-hydroxyvitamin D3 1-alpha-hydroxylase) (VD3 1A hydroxylase) (P450C1 alpha) (P450VD1-alpha); 25-hydroxyvitamin D3 1alpha-hydroxylase; 25-OHD-1 alpha-hydroxylase; Calcidiol 1-monooxygenase; Cp2b; cy; Cyp1; CYP1alpha; Cyp27b; Cyp27b1; Cyp40; cytochrome p450 27B1; cytochrome P450 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450 family 27 subfamily B member 1; cytochrome P450 subfamily XXVIIB (25-hydroxyvitamin D-1-alpha-hydroxylase) polypeptide 1; cytochrome P450 subfamily XXVIIB polypeptide 1; cytochrome P450, 27b1; cytochrome P450, 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450, family 27, subfamily B, polypeptide 1; cytochrome P450, subfamily 27b, polypeptide 1; cytochrome P450C1 alpha; Cytochrome P450VD1-alpha; P450c1; P450C1 alpha; P450VD1alpha; P450VD1-alpha; Pddr; VD3 1A hydroxylase; Vdd1; Vddr; VDDRI; VDR
Gene	CYP27B1
Product Type	Antibody
Gene ID (Entrez)	114700, 13115, 1594
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human CYP27B1 (475-508aa HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR).
Classification	Polyclonal
Primary or Secondary	Primary

3,644

Invitrogen™ CD178 (Fas Ligand) Monoclonal Antibody (NOK-1), APC, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P48023
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	CD178 (Fas Ligand)
Gene Symbols	Faslg
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	ADAM10-processed FasL form; ALPS1B; APL; Apoptosis (APO 1) antigen ligand 1; apoptosis (APO-1) antigen ligand 1; Apoptosis (APO-1) antigen ligand 1 (Fas antigen ligand); apoptosis antigen ligand; APT1LG1; APTL; CD178; CD178 antigen; CD95 ligand; CD95 ligand protein;Generalized lymphoproliferative disease (Gld); Cd95l; CD95-L; CD95L protein; fas antigen ligand; Fas ligand; Fas ligand (TNF superfamily, member 6); Fasl; Fas-L; FasL ICD; FasL intracellular domain; Faslg; Fas-LG; generalized lymphoproliferative disease; gld; mutant tumor necrosis factor family member 6; Receptor-binding FasL ectodomain; sFasL; Soluble Fas ligand; soluble form; SPA; SPPL2A-processed FasL form; TNFL; Tnfsf6; TNLG1A; Tumor necrosis factor (ligand) superfamily member 6; Tumor necrosis factor (ligand) superfamily member 6 (apoptosis (APO-1) antigen ligand 1) (Fas antigen ligand); Tumor necrosis factor (ligand) superfamily, member 6 (apoptosis (APO-1) antigen ligand 1) (Fas antigen ligand); Tumor necrosis factor ligand; tumor necrosis factor ligand 1A; tumor necrosis factor ligand superfamily member 6; Tumor necrosis factor ligand superfamily member 6 (TNFL6 / TNFSF6); Tumor necrosis factor ligand superfamily member 6, membrane form; Tumor necrosis factor ligand superfamily member 6, soluble form
Gene	Faslg
Product Type	Antibody
Gene ID (Entrez)	356
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	NOK-1

3,645

Invitrogen™ GLP-1 Monoclonal Antibody (03)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Western Blot
Form	Liquid
Gene Accession No.	P01275
Isotype	IgG1 κ
Concentration	1.03 mg/mL
Antigen	GLP-1
Gene Symbols	GCG
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	GCG; Glicentin; Glicentin-related polypeptide; GLP1; GLP-1; GLP-1(7-36); GLP-1(7-37); GLP1/2; GLP2; GLP-2; Glu; glucagon; Glucagon like peptide 1; Glucagon-like peptide 1; Glucagon-like peptide 1(7-36); Glucagon-like peptide 1(7-37); Glucagon-like peptide 2; glucagon-like peptide-1; GRPP; Incretin hormone; MGC138331; OXM; OXY; Oxyntomodulin; PPG; preproglucagon
Gene	GCG
Product Type	Antibody
Gene ID (Entrez)	2641
Formulation	PBS with 15mM sodium azide; pH 7.4
Immunogen	Synthetic GLP-1(9-37) adsorbed onto aluminum hydroxide gel.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	03

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ CD59 (Protectin) Recombinant Rabbit Monoclonal Antibody (JM10-71) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ULK1 Recombinant Rabbit Monoclonal Antibody (JA58-36) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD31 (PECAM-1) Recombinant Rabbit Monoclonal Antibody (7O7K3) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD16 Recombinant Rabbit Monoclonal Antibody (JE49-79) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Ferroportin Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ BSND Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

IRF8 Monoclonal Antibody (V3GYWCH), Alexa Fluor™ 488, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SFTPC Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD23 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

ID2 Monoclonal Antibody (ILCID2), APC, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ BIK Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD55 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CYP27B1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD178 (Fas Ligand) Monoclonal Antibody (NOK-1), APC, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GLP-1 Monoclonal Antibody (03) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD59 (Protectin) Recombinant Rabbit Monoclonal Antibody (JM10-71)

Invitrogen™ ULK1 Recombinant Rabbit Monoclonal Antibody (JA58-36)

Invitrogen™ CD31 (PECAM-1) Recombinant Rabbit Monoclonal Antibody (7O7K3)

Invitrogen™ CD16 Recombinant Rabbit Monoclonal Antibody (JE49-79)

Invitrogen™ Ferroportin Polyclonal Antibody

Invitrogen™ BSND Polyclonal Antibody

IRF8 Monoclonal Antibody (V3GYWCH), Alexa Fluor™ 488, eBioscience™, Invitrogen™

Invitrogen™ SFTPC Polyclonal Antibody

Invitrogen™ CD23 Polyclonal Antibody

ID2 Monoclonal Antibody (ILCID2), APC, eBioscience™, Invitrogen™

Invitrogen™ BIK Polyclonal Antibody

Invitrogen™ CD55 Polyclonal Antibody

Invitrogen™ CYP27B1 Polyclonal Antibody

Invitrogen™ CD178 (Fas Ligand) Monoclonal Antibody (NOK-1), APC, eBioscience™

Invitrogen™ GLP-1 Monoclonal Antibody (03)