Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

3,736 – 3,750 of 1,824,522 results

3,736

MHC Class I (H-2Kd/H-2Dd) Monoclonal Antibody (34-1-2S), PE, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Mouse
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P01895, P01896, P01897, P01899, P01900, P01901, P03991, P04223, P14426, P14427, P14428
Concentration	0.2 mg/mL
Antigen	MHC Class I (H-2Kd/H-2Dd)
Gene Symbols	H2-D1, H2-K1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	class I major histocompatibility antigen H-2Kd; H-2 class I histocompatibility antigen, D-B alpha chain; H-2 class I histocompatibility antigen, K-B alpha chain; H-2 class I histocompatibility antigen, K-D alpha chain; H-2 class I histocompatibility antigen, K-K alpha chain; H-2 class I histocompatibility antigen, K-Q alpha chain; H-2 class I histocompatibility antigen, K-W28 alpha chain; H-2D; H2-D; H-2D cell surface glycoprotein; H-2D(B); H2-D1; H2-DC1-beta transplantation antigen protein; H2DD; H-2K; H2-K; H-2K(B); H-2K(d); H-2K(K); H-2K(Q); H2K1; H2-K1; H2KD; histocompatibility 2, D region locus 1; histocompatibility 2, K1, K region; K-f; MHC class I antigen; MHC class I H2 antigen; MHC class I H-2Dp; MHC class I H2-K-b-alpha-2 cell surface glycoprotein; MHC class I heavy chain H2-K; MHC H2-D-q alpha-chain; MHC H2-K transplantation antigen; Q5k protein
Product Type	Antibody
Gene ID (Entrez)	14964, 14972
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	34-1-2S

3,737

Invitrogen™ MHC Class I Monoclonal Antibody (IVA26)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Human,Mouse,Rabbit,Bovine,Sheep,Pig,Avian
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Frozen),Immunoprecipitation
Form	Liquid
Gene Accession No.	P04439
Isotype	IgG1
Concentration	1 mg/mL
Antigen	MHC Class I
Gene Symbols	HLA-A, OLA-I, OVAR
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	A29 protein; alpha chain 2; antigen presentation; antigen presentation; BFIV major; BF12 major; antigen presenting molecule; Aw-33; Aw-74; B12; BF; B-F; B-F antigen; G-B1; B-F histocompatibility F10 antigen; B-F major; B-F minor; BF1; B-F1; BF12; BF2; BFa1; BFa2; B-F-beta-IV; B-FI; BFIV; B-FIV; BFIV21; B-F-S01; B-F-S02; B-F-S03; B-F-S04; B-F-S05; B-F-S06; B-F-S07; B-F-S09; B-F-S11; B-F-S12; B-F-S13; B-F-S14; BFw-03; BFw-05; BFz-01; B-LB2; BOLA class I histocompatibility antigen, alpha chain BL3-7-like; chicken MHC class I antigen; class I histocompatibility antigen, F10 alpha chain; EA1.2; EA2.1; F10 alpha chain; HFE; HLA A; HLA class I antigen; HLA class I histocompatibility antigen, A alpha chain; HLA class I histocompatibility antigen, A-1 alpha chain; HLA class I histocompatibility antigen, A-30 alpha chain; HLA class I histocompatibility antigen, A-33 alpha chain; HLA class I histocompatibility antigen, A-74 alpha chain; HLA class I histocompatibility antigen, alpha chain E; HLA class I histocompatibility antigen, E alpha chain; HLA locus; HLA-6.2; HLAA; HLA-A; HLA-A locus alpha 2 domain; HLA-A null; HLA-A11; HLA-A33; HLA-Aw33.1; HLA-DQB1; HLA-DRB1; HLAE; HLA-E; Human leukocyte antigen A; leukocyte antigen class I-A; lymphocyte antigen; major class I glycoprotein; Major histocompatibility complex class I antigen BF2; major histocompatibility complex class I glycoprotein; major histocompatibility complex class I glycoprotein haplotype B21; major histocompatibility complex, class I, A; major histocompatibility complex, class I, E; major histocompatibility complex, class I, G; MCH class I antigen; MHC; MHC BF1 class I; MHC BF2 class I; MHC class 1 antigen; MHC class I; MHC class I alpha chain 1; MHC class I alpha chain 2; MHC class I anti; MHC Class I antigen; MHC class I antigen A30; MHC class I antigen A33; MHC class I antigen A*74; MHC class I antigen alpha chain; MHC class I antigen B-F heavy chain; MHC class I antigen B-F major heavy chain; MHC class I antigen B-F minor heavy chain; MHC class I antigen E; MHC class I antigen heavy chain; MHC class I antigen HLA-A heavy chain; MHC class I antigen HLA-A33; MHC class I antigen null protein; MHC class I antigene; MHC class I B-F heavy chain; MHC class I glycoprotein; MHC class I heavy chain B-F; MHC class I molecule; MHC class I-alpha; MHC class II antigen; MHC class1 antigen; MHC classI antigen; MHC HLA-E alpha-1; MHC HLA-E alpha-2.1; minor antigen; minor class I glycoprotein; OLA-I; OVAR; Ovar-I; ovar-MHCI-B564; ovar-MHCI-D5; ovar-MHCI-F12; put. F10 preprotein (AA -22 to 323); QA1; sHLA-E; Soluble HLA class I histocompatibility antigen, alpha chain E; truncated MHC class I antigen
Gene	HLA-A
Product Type	Antibody
Gene ID (Entrez)	100171394, 101108963, 3105
Formulation	PBS with 15mM sodium azide; pH 7.4
Immunogen	bovine lymphocytes.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	IVA26

3,738

CD127 Monoclonal Antibody (eBioRDR5), Brilliant Ultra Violet™ 737, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Ultraviolet 737
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P16871
Concentration	5 μL/Test
Antigen	CD127
Gene Symbols	Il7r
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD127; CD127 antigen; CDW127; IL 7 receptor; IL 7R a; IL 7R subunit alpha; IL 7R α; IL 7Ra; IL 7Rα; IL7 receptor; IL-7 receptor alpha chain; IL7 receptor subunit alpha; IL-7 receptor subunit alpha; IL7R; IL-7R; IL7R a; IL7R alpha; IL7R subunit alpha; IL-7R subunit alpha; IL7R α; IL7RA; IL-7RA; IL-7Ralpha; IL-7R-alpha; IL7Rα; ILRA; interleukin 7 receptor; interleukin 7 receptor alpha chain; interleukin 7 receptor isoform H5-6; Interleukin7 receptor subunit alpha; interleukin-7 receptor subunit alpha; MGC107557; sCD127; soluble IL 7 receptor; soluble IL 7R
Gene	Il7r
Gene ID (Entrez)	3575
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	eBioRDR5

3,739

CD86 (B7-2) Monoclonal Antibody (GL1), Biotin, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Biotin
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P42082
Concentration	0.5 mg/mL
Antigen	CD86 (B7-2)
Regulatory Status	RUO
Purification Method	Affinity chromatography
Product Type	Antibody
Gene ID (Entrez)	12524
Classification	Monoclonal
Primary or Secondary	Primary
Clone	GL1

3,740

EGR2 Monoclonal Antibody (erongr2), PE, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P08152
Concentration	0.2 mg/mL
Antigen	EGR2
Gene Symbols	Egr2
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AT591; CMT1D; CMT4E; DKFZp686J1957; E3 SUMO-protein ligase EGR2; E3 SUMO-protein transferase ERG2; early growth response 2; early growth response protein 2; Egr2; Egr-2; FLJ1454; FLJ14547; Krox20; Krox-20; Krox-20 homolog; KROX-20, Drosophila, homolog (early growth response-2); NGF1-B; OTTHUMP00000062133; Zfp-25; Zfp-6; Zinc finger protein Krox-20
Gene	Egr2
Product Type	Antibody
Gene ID (Entrez)	13654
Formulation	PBS with 0.09% sodium azide; pH 7.2
Immunogen	E. coli-derived protein, aa 1-319.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	erongr2

3,741

CD265 (RANK) Monoclonal Antibody (R12-31), PE, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	O35305
Concentration	0.2 mg/mL
Antigen	CD265 (RANK)
Regulatory Status	RUO
Purification Method	Affinity chromatography
Product Type	Antibody
Gene ID (Entrez)	21934
Classification	Monoclonal
Primary or Secondary	Primary
Clone	R12-31

3,742

CD90.1 (Thy-1.1) Monoclonal Antibody (HIS51), Biotin, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse,Rat
Host Species	Mouse
Conjugate	Biotin
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P01830, P01831
Concentration	0.5 mg/mL
Antigen	CD90.1 (Thy-1.1)
Gene Symbols	Thy1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD7; CD90; FLJ33325; T25; Thy 1.2; Thy1; Thy-1; Thy-1 antigen; Thy-1 cell surface antigen; thy-1 glycoprotein; thy-1 membrane glycoprotein; Thy-1 protein; Thy1.1; Thy1.2; Thy-1.2; thymus cell antigen 1, theta; Thymus cell surface antigen
Gene	Thy1
Product Type	Antibody
Gene ID (Entrez)	21838, 24832
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	HIS51

3,743

Invitrogen™ HuD Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	O09032, P26378, Q61701
Isotype	IgG
Concentration	500 μg/mL
Antigen	HuD
Gene Symbols	ELAVL4
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Elav; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D); ELAV like neuron-specific RNA binding protein 4; ELAVL4; ELAV-like protein 4; Hu antigen D; HU-antigen D; Hud; Paraneoplastic encephalomyelitis antigen HuD; PNEM; RGD1561943; r-HuD; RNA-binding protein HUD3
Gene	ELAVL4
Product Type	Antibody
Gene ID (Entrez)	15572, 1996, 432358
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human ELAVL4 (8-45aa MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK).
Classification	Polyclonal
Primary or Secondary	Primary

3,744

Invitrogen™ CD23 Monoclonal Antibody (B3B4), Biotin, eBioscience™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Biotin
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P20693
Isotype	IgG2a κ
Concentration	0.5 mg/mL
Antigen	CD23
Gene Symbols	Fcer2a
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	BLAST-2; CD23; CD23 antigen; CD23A; CLEC4J; C-type lectin domain family 4 member J; C-type lectin domain family 4, member J; Fc epsilon receptor II; FC epsilon RII; Fc fragment of IgE receptor II; Fc fragment of IgE, low affinity II, receptor for (CD23); Fc receptor alpha multiple ligand receptor; Fc receptor, IgE, low affinity II, alpha polypeptide; Fcalpha muR; Fcalpha RII; Fce2; fc-epsilon-RII; FCER2; Fcer2a; FceRII; IGEBF; Immunoglobulin E-binding factor; immunoglobulin epsilon-chain; low affinity immunoglobulin epsilon Fc receptor; Low affinity immunoglobulin epsilon Fc receptor membrane-bound form; Low affinity immunoglobulin epsilon Fc receptor soluble form; low-affinity IgE receptor; Ly-42; lymphocyte IgE receptor
Gene	Fcer2a
Product Type	Antibody
Gene ID (Entrez)	14128
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	B3B4

3,745

Invitrogen™ ZO-3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat,Canine
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O62683, O95049, Q9QXY1
Isotype	IgG
Concentration	0.25 mg/mL
Antigen	ZO-3
Gene Symbols	TJP3
Regulatory Status	RUO
Purification Method	Antigen Affinity Chromatography
Gene Alias	tight junction protein 3; tight junction protein 3 (zona occludens 3); tight junction protein ZO-3; TJP3; TJP-3; ZO3; ZO-3; Zona occludens protein 3; zonula occludens protein 3
Gene	TJP3
Product Type	Antibody
Gene ID (Entrez)	27134, 27375, 314640, 403852
Formulation	PBS with 0.1% sodium azide; pH 7.4
Immunogen	Synthetic peptide derived from an internal region of the human ZO-3 protein.
Classification	Polyclonal
Primary or Secondary	Primary

3,746

Invitrogen™ MLKL Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunoprecipitation,Western Blot
Form	Liquid
Gene Accession No.	Q8NB16
Isotype	IgG
Concentration	0.52 mg/mL
Antigen	MLKL
Gene Symbols	Mlkl
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	9130019I15Rik; hMLKL; mixed lineage kinase domain like pseudokinase; mixed lineage kinase domain-like; mixed lineage kinase domain-like protein; Mlkl; rCG51567-like
Gene	Mlkl
Product Type	Antibody
Gene ID (Entrez)	197259
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human MLKL. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

3,747

CD123 Monoclonal Antibody (6H6), PerCP-Cyanine5.5, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	PerCP-Cyanine5.5
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P26951
Concentration	5 μL/Test
Antigen	CD123
Gene Symbols	IL3RA
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD123; CD123 antigen; CDw123; Cyrl; cytokine receptor-like protein CYRL; hIL-3Ra; Il-3 alpha subunit; IL-3 receptor alpha chain; IL-3 receptor alpha SP2 isoform; IL-3 receptor subunit alpha; IL3R; IL-3R subunit alpha; Il3ra; IL-3RA; IL-3R-alpha; IL3RAY; IL3RX; IL3RY; interleukin 3 receptor subunit alpha; interleukin 3 receptor, alpha; interleukin 3 receptor, alpha (low affinity); interleukin 3 receptor, alpha chain; interleukin-3 receptor class II alpha chain; Interleukin-3 receptor subunit alpha; Sut-1
Gene	IL3RA
Product Type	Antibody
Gene ID (Entrez)	3563
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	6H6

3,748

CD48 Monoclonal Antibody (HM48-1), APC, eBioscience™, Invitrogen™

Armenian Hamster Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Armenian Hamster
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG
Gene Accession No.	P18181
Concentration	0.2 mg/mL
Antigen	CD48
Gene Symbols	Cd48
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI449234; AW610730; B-cell activation marker; BCM1; Bcm-1; BCM1 surface antigen; BLAST; BLAST1; BLAST-1; B-lymphocyte activation marker BLAST-1; Cd48; CD48 antigen; CD48 antigen (B cell membrane protein); CD48 antigen (B-cell membrane protein); Cd48 molecule; CD48d; hCD48; HM48-1; leukocyte antigen MEM-102; mCD48; MEM-102; MRC OX-45 surface antigen; sCD 48; sCD48; Sgp-60; Signaling lymphocytic activation molecule 2; Signaling lymphocytic activation molecule 2 (SLAMF2); SLAM family member 2; SLAMF2; soluble CD 48; soluble CD48; TCT.1
Gene	Cd48
Product Type	Antibody
Gene ID (Entrez)	12506
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	HM48-1

3,749

Granzyme A Monoclonal Antibody (GzA-3G8.5), eFluor™ 450, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Mouse
Conjugate	eFluor 450
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2b κ
Gene Accession No.	P11032
Concentration	0.2 mg/mL
Antigen	Granzyme A
Gene Symbols	GZMA
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Autocrine thymic lymphoma granzyme-like serine protease; AW494114; BLT esterase; CTL tryptase; CTLA3; CTLA-3; Cytotoxic T-lymphocyte proteinase 1; Cytotoxic T-lymphocyte-associated serine esterase-3; fragmentin-1; granzyme 1; granzyme A; Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factor serine protease); granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3); Granzyme-1; GZMA; H factor; Hanukah factor; Hanukah factor serine protease); Hanukkah factor; Hf; HFSP; Mtsp-1; SE1; serine esterase 1; t cell-specific serine protease 1; TSP1; TSP-1
Gene	GZMA
Product Type	Antibody
Gene ID (Entrez)	14938
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	GzA-3G8.5

3,750

Invitrogen™ SCGN Polyclonal Antibody

Chicken Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Chicken
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Immunohistochemistry (PFA fixed),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O76038, Q6R556, Q91WD9
Isotype	IgY
Concentration	1 mg/mL
Antigen	SCGN
Gene Symbols	SCGN
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CALBL; DJ501N12.8; SCGN; SECRET; Secretagogin; secretagogin, EF-hand calcium binding protein; SEGN; setagin
Gene	SCGN
Product Type	Antibody
Gene ID (Entrez)	10590, 214189, 306942
Formulation	PBS with 50% glycerol and 5 mM sodium azide
Immunogen	Full-length recombinant human secretagogin protein.
Classification	Polyclonal
Primary or Secondary	Primary

Primary Antibodies

Filtered Search Results

Narrow Results

MHC Class I (H-2Kd/H-2Dd) Monoclonal Antibody (34-1-2S), PE, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MHC Class I Monoclonal Antibody (IVA26) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD127 Monoclonal Antibody (eBioRDR5), Brilliant Ultra Violet™ 737, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD86 (B7-2) Monoclonal Antibody (GL1), Biotin, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

EGR2 Monoclonal Antibody (erongr2), PE, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD265 (RANK) Monoclonal Antibody (R12-31), PE, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD90.1 (Thy-1.1) Monoclonal Antibody (HIS51), Biotin, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ HuD Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD23 Monoclonal Antibody (B3B4), Biotin, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ZO-3 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MLKL Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD123 Monoclonal Antibody (6H6), PerCP-Cyanine5.5, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD48 Monoclonal Antibody (HM48-1), APC, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Granzyme A Monoclonal Antibody (GzA-3G8.5), eFluor™ 450, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SCGN Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

MHC Class I (H-2Kd/H-2Dd) Monoclonal Antibody (34-1-2S), PE, eBioscience™, Invitrogen™

Invitrogen™ MHC Class I Monoclonal Antibody (IVA26)

CD127 Monoclonal Antibody (eBioRDR5), Brilliant Ultra Violet™ 737, eBioscience™, Invitrogen™

CD86 (B7-2) Monoclonal Antibody (GL1), Biotin, eBioscience™, Invitrogen™

EGR2 Monoclonal Antibody (erongr2), PE, eBioscience™, Invitrogen™

CD265 (RANK) Monoclonal Antibody (R12-31), PE, eBioscience™, Invitrogen™

CD90.1 (Thy-1.1) Monoclonal Antibody (HIS51), Biotin, eBioscience™, Invitrogen™

Invitrogen™ HuD Polyclonal Antibody

Invitrogen™ CD23 Monoclonal Antibody (B3B4), Biotin, eBioscience™

Invitrogen™ ZO-3 Polyclonal Antibody

Invitrogen™ MLKL Polyclonal Antibody

CD123 Monoclonal Antibody (6H6), PerCP-Cyanine5.5, eBioscience™, Invitrogen™

CD48 Monoclonal Antibody (HM48-1), APC, eBioscience™, Invitrogen™

Granzyme A Monoclonal Antibody (GzA-3G8.5), eFluor™ 450, eBioscience™, Invitrogen™

Invitrogen™ SCGN Polyclonal Antibody