Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

5,761 – 5,775 of 1,824,471 results

5,761

Invitrogen™ Phospho AKT1 (Ser473) Recombinant Mouse Monoclonal Antibody (SDRNR), Alexa Fluor™ Plus 647

Mouse Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Alexa Fluor Plus 647
Applications	Flow Cytometry,Western Blot
Form	Liquid
Gene Accession No.	P31749
Isotype	IgG2a κ
Concentration	1 mg/mL
Antigen	Phospho AKT1 (Ser473)
Gene Symbols	AKT1
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	AKT; Akt kinase; AKT serine/threonine kinase 1; Akt/PKB; akt1; AKT1 kinase; AKT1m; Akt1m protein; Akt1-PA; Akt1-PB; Akt1-PC; Akt1-PD; Akt1-PE; CAKT; C-AKT; CG4006; CG4006-PA; CG4006-PB; CG4006-PC; CG4006-PD; CG4006-PE; CWS6; dAkt; D-Akt; dAkt kinase; dAKT/dPKB; dAkt/PKB; DAKT1; DAKT1/PKB; Dmel\CG4006; Dmel_CG4006; dPKB; DRAC-PK; DRAC-PK66; DRAC-PK85; l(3)04226; l(3)89Bq; murine thymoma viral (v-akt) oncogene homolog 1; pAkt; P-AKT; PKB; PKB alpha; PKB beta; PKB gamma; PKB/AKT; PKB/dAKT; PKBalpha; PKB-ALPHA; PKBG; PRKBA; protein kinase B; Protein kinase B alpha; protein kinase B-alpha; proto-oncogene c-Akt; RAC; rac protein kinase alpha; RAC protein kinase alpha RAC-PK alpha; RAC serine/threonine protein kinase; RAC serine/threonine-protein kinase; RAC-ALPHA; RAC-ALPHA SERINE/THREONINE-PROTEIN KINASE; RacPK; RAC-PK-alpha; RAC-PK-beta; RAC-PK-gamma; related to A and C kinases; related to PKA to PKC protein kinases; related to the A and C kinases; SD10374p; serine/threonine protein kinase; serine-threonine protein kinase; Thymoma viral proto-oncogene; thymoma viral proto-oncogene 1; v-akt murine thymoma viral oncogene homolog 1; V-AKT MURINE THYMOMA VIRAL ONCOGENE-LIKE PROTEIN 1
Gene	AKT1
Product Type	Antibody
Gene ID (Entrez)	207
Formulation	Proprietary buffer with 0.008% Bromonitrodioxane, 0.008% Methylisothiazolone; pH 6.3-7.3
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	SDRNR

5,762

Invitrogen™ PNPase Recombinant Rabbit Monoclonal Antibody (24H24L10)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry,Western Blot
Form	Liquid
Gene Accession No.	Q8TCS8
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	PNPase
Gene Symbols	PNPT1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	1200003F12Rik; 3'-5' RNA exonuclease OLD35; COXPD13; DFNB70; DKFZp762K1914; old 35; Old35; old-35; PNPase; PNPase 1; PNPase old-35; Pnpt1; Pnptl1; polynucleotide phosphorylase 1; Polynucleotide phosphorylase-like protein; polyribonucleotide nucleotidyltransferase 1; polyribonucleotide nucleotidyltransferase 1, mitochondrial
Gene	PNPT1
Product Type	Antibody
Gene ID (Entrez)	87178
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Protein corresponding to human PNPase [aa46-aa669].
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	24H24L10

5,763

Invitrogen™ Phospho-Tau (Thr181) Recombinant Superclonal™ Antibody (5HCLC)

Rabbit Recombinant Superclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P10636, P10637, P19332
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	Phospho-Tau (Thr181)
Gene Symbols	MAPT
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	AI413597; AW045860; DDPAC; FLJ31424; FTDP17; FTDP-17; G protein beta1/gamma2 subunit-interacting factor 1; map tau; Mapt; MAPTL; MGC138549; microtubule associated protein tau; microtubule-associated protein tau; microtubule-associated protein tau, isoform 4; microtubules; MSTD; Mtapt; MTBT1; MTBT2; Neurofibrillary tangle protein; neurofibrillary tangles; Neuronal Marker; paired helical filament-tau; PHFtau; PHF-tau; PPND; PPP1R103; protein phosphatase 1, regulatory subunit 103; pTau; RNPTAU; Tau; Tau microtubule-associated protein; tau protein; Tau-4; Tau5; Unknown (protein for MGC:134287)
Gene	MAPT
Product Type	Antibody
Gene ID (Entrez)	17762, 29477, 4137
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	human Tau around phosphorylated Tyrosine 181.
Classification	Recombinant Superclonal
Primary or Secondary	Primary
Clone	5HCLC

5,764

Invitrogen™ CD54 (ICAM-1) Monoclonal Antibody (HA58), Functional Grade, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human
Host Species	Mouse
Conjugate	Functional Grade
Applications	Flow Cytometry,Functional Assay,Neutralization
Form	Liquid
Gene Accession No.	P05362
Isotype	IgG1 κ
Concentration	1 mg/mL
Antigen	CD54 (ICAM-1)
Gene Symbols	ICAM1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	BB2; CD54; cell surface glycoprotein P3.58; Human rhinovirus receptor; ICAM; Icam1; ICAM-1; ICAM-1; CD54 homolog; Intercellular adhesion molecule 1; intercellular adhesion molecule 1 (CD54), human rhinovirus receptor; intercellular adhesion molecule-1; intercellular adhesion molecule-1 precursor; Ly 47; Ly-47; major group rhinovirus receptor; MALA2; MALA-2; MyD10; P3.58; sCD54; soluble CD54; Surface antigen of activated B cells
Gene	ICAM1
Product Type	Antibody
Gene ID (Entrez)	3383
Formulation	PBS with no preservative; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	HA58

5,765

Invitrogen™ GPR176 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	Q14439, Q80WT4
Isotype	IgG
Concentration	Conc. Not Determined
Antigen	GPR176
Gene Symbols	GPR176
Regulatory Status	RUO
Gene Alias	Agr9; G protein-coupled receptor 176; Gm1012; Gpr; GPR176; G-protein coupled receptor 176; G-protein coupled receptor AGR9; HB954; HB-954; probable G-protein coupled receptor 176; putative G protein coupled receptor; RBU-15
Gene	GPR176
Product Type	Antibody
Gene ID (Entrez)	11245, 381413
Formulation	Whole Serum with 0.05% sodium azide
Immunogen	KLH conjugated COOH-terminal amino acids of 496-515 (RVERKMSRNNKVSIFPKVDS).
Classification	Polyclonal
Primary or Secondary	Primary

5,766

Invitrogen™ SPTLC2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Maintain refrigerated at 2-8°C for up to 3 months. For long term storage store at -20°C
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O15270, P97363
Isotype	IgG
Concentration	1 mg/mL
Antigen	SPTLC2
Gene Symbols	SPTLC2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI173915; hLCB2a; HSN1C; KIAA0526; LCB 2; LCB2; LCB2a; long chain base biosynthesis protein 2; Long chain base biosynthesis protein 2a; mKIAA0526; NSAN1C; Pomt2; protein-O-mannosyltransferase 2; serine palmitoyltransferase 2; serine palmitoyltransferase long chain base subunit 2; serine palmitoyltransferase, long chain base subunit 2; serine palmitoyltransferase, subunit II; serine-palmitoyl-CoA transferase 2; SPT 2; SPT2; Sptlc2
Gene	SPTLC2
Product Type	Antibody
Gene ID (Entrez)	20773, 9517
Formulation	PBS with 0.02% sodium azide
Immunogen	A 15 amino acid peptide near the carboxy terminus of human SPT2.
Classification	Polyclonal
Primary or Secondary	Primary

5,767

CD279 (PD-1) Monoclonal Antibody (RMP1-14), Functional Grade, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Rat
Conjugate	Functional Grade
Applications	Flow Cytometry,Functional Assay
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	Q02242
Concentration	1 mg/mL
Antigen	CD279 (PD-1)
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene	Pdcd1
Product Type	Antibody
Gene ID (Entrez)	18566
Formulation	PBS with no preservative; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	RMP1-14

5,768

Invitrogen™ CD13 Monoclonal Antibody (R3-63)

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Mouse
Host Species	Rat
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunocytochemistry
Form	Liquid
Gene Accession No.	P97449
Isotype	IgG2a
Concentration	1 mg/mL
Antigen	CD13
Gene Symbols	ANPEP
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	alanyl (membrane) aminopeptidase; alanyl (membrane) aminopeptidase (aminopeptidase N, aminopeptidase M, microsomal aminopeptidase, CD13, p150); alanyl aminopeptidase; alanyl aminopeptidase, membrane; aminopeptidase; aminopeptidase Ey; Aminopeptidase M; aminopeptidase N; aminopeptidase N.; aminopeptidase N/CD13; Anpep; APDE; Apm; AP-M; APN; AP-N; bAPN; cAPN; Cd13; cluster of differentiation antigen 13 (CD13); fAPN; gp130; gp150; h AP-N; hAPN; kidney aminopeptidase M; kidney Zn peptidase; KZP; Lap1; Lap-1; leucine arylaminopeptidase 1; LOW QUALITY PROTEIN: aminopeptidase N; membrane alanine aminiopeptidase; membrane alanine aminopeptidase; membrane alanyl aminopeptidase; membrane protein p161; Microsomal aminopeptidase; myeloid plasma membrane glycoprotein CD13; p150; pAPN; PEPN; porcine aminopeptidase N; rAPN; rbAPN; Unknown (protein for MGC:126949)
Gene	ANPEP
Product Type	Antibody
Gene ID (Entrez)	16790
Formulation	PBS with 0.09% sodium azide
Immunogen	Mouse intestinal CD13.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	R3-63

5,769

Invitrogen™ CRB1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P82279, Q8VHS2
Isotype	IgG
Concentration	500 μg/mL
Antigen	CRB1
Gene Symbols	CRB1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	CRB1; crumbs 1, cell polarity complex component; crumbs family member 1, photoreceptor morphogenesis associated; Crumbs homolog 1; LCA8; Protein crumbs homolog 1; RP12
Gene	CRB1
Product Type	Antibody
Gene ID (Entrez)	170788, 23418, 304825
Formulation	PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence of human CRB1 (FRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQ).
Classification	Polyclonal
Primary or Secondary	Primary

5,770

Invitrogen™ Human IgD Monoclonal Antibody (IA6-2), Brilliant Violet™ 786, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Violet 786
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P01880
Isotype	IgG2a κ
Concentration	5 μL/Test
Antigen	Human IgD
Gene Symbols	IGHD
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Ig delta chain constant region; IGHD; IGHD1; IGHDELTA; immunoglobulin heavy constant delta
Gene	IGHD
Product Type	Antibody
Gene ID (Entrez)	3495
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	IA6-2

5,771

Invitrogen™ SOX5 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Pig,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Lyophilized
Gene Accession No.	P35710, P35711
Isotype	IgG
Concentration	500 μg/mL
Antigen	SOX5
Gene Symbols	SOX5
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	A730017D01Rik; AI528773; LAMSHF; L-SOX5; L-SOX5B; L-SOX5F; MGC35153; Sox5; Sox-5; Sox5-BLM isoform; Sox5l1; SRY (sex determining region Y)-box 5; SRY box 5; SRY-box 5; SRY-box containing gene 5; SRY-box containing gene 5-like 1; SRY-box transcription factor 5; SRY-related HMG-box 5 protein; transcription factor SOX-5
Gene	SOX5
Product Type	Antibody
Gene ID (Entrez)	100627965, 140587, 20678, 6660
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human SOX5 (495-528aa EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS).
Classification	Polyclonal
Primary or Secondary	Primary

5,772

Invitrogen™ CD105 (Endoglin) Monoclonal Antibody (SN6), Brilliant Violet™ 421, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Violet 421
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P17813
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	CD105 (Endoglin)
Gene Symbols	ENG
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI528660; AI662476; CD105; CD105 antigen; cell surface MJ7/18 antigen; Edg; END; Endo; Endoglin; endoglin (Osler-Rendu-Weber syndrome 1); Eng; HHT1; ORW; ORW1; S-endoglin; transmembrane glycoprotein
Gene	ENG
Product Type	Antibody
Gene ID (Entrez)	2022
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	SN6

5,773

Invitrogen™ TNF alpha Monoclonal Antibody (68B6A3 L1)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry
Form	Liquid
Gene Accession No.	P01375
Isotype	IgG1
Concentration	1 mg/mL
Antigen	TNF alpha
Gene Symbols	Tnf
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	APC1 protein; Cachectin; C-domain 1; C-domain 2; cTNF; DADB-70P7.1; DIF; ICD1; ICD2; Intracellular domain 1; Intracellular domain 2; N-terminal fragment; NTF; RATTNF; Tnf; TNF alpha; TNF superfamily; TNF α; TNF, macrophage-derived; TNF, monocyte-derived; TNFA; TNF-a; TNFalpha; TNF-alpha; Tnfsf1a; TNFSF2; TNFα; TNLG1F; Tumor necrosis factor; tumor necrosis factor (TNF superfamily, member 2); tumor necrosis factor alpha; tumor necrosis factor alpha (cachetin); tumor necrosis factor alpha precursor; tumor necrosis factor ligand 1F; tumor necrosis factor ligand superfamily member 2; Tumor necrosis factor, membrane form; Tumor necrosis factor, soluble form; tumor necrosis factor-alpha; tumor necrosis factor-alpha precursor; tumor-necrosis factor; tumour necrosis factor
Gene	Tnf
Product Type	Antibody
Gene ID (Entrez)	7124
Formulation	PBS with 0.5mg/mL sodium azide; pH 7.4
Immunogen	Recombinant human TNF-alpha.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	68B6A3 L1

5,774

Invitrogen™ beta Catenin Monoclonal Antibody (15B8), Alexa Fluor™ Plus 647

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Human
Host Species	Mouse
Conjugate	Alexa Fluor Plus 647
Applications	Immunohistochemistry (Paraffin),Multiplex Immunohistochemistry
Form	Liquid
Gene Accession No.	P35222
Isotype	IgG1 κ
Concentration	0.2 mg/mL
Antigen	beta Catenin
Gene Symbols	CTNNB1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	armadillo; armadillo homolog; Bcatenin; b-catenin; beta 1 88kDa; beta catenin; Betacatenin; beta-catenin; beta-catenin 1; Bfc; C20orf33; Cadherin associated protein; catenin; catenin (cadherin associated protein), beta 1; catenin (cadherin associated protein), beta 1, 88kDa; catenin (cadherin-associated protein) beta 1; catenin (cadherin-associated protein), beta 1; catenin (cadherin-associated protein), beta 1, 88kDa; Catenin b 1; Catenin b1; catenin beta; catenin beta 1; catenin beta 1 L homeolog; Catenin beta1; Catenin beta-1; Catenin β 1; Catenin β1; Catnb; CHBCAT; CTNB1; CTNNB; ctnnb1; ctnnb1.L; ctnnb1-a; ctnnb1-b; dJ633O20.1; DKFZp686D02253; FLJ25606; FLJ37923; id:ibd2058; Mesc; MRD19; NAP; NYD-SP19; OK/SW-cl.35; OTTHUMP00000209289; P14L; PP8304; PRO2286; RP5-1118M15.1; wu:fb73e10; wu:fi81c06; wu:fk25h01; XELAEV_18031149mg; β catenin; βcatenin
Gene	CTNNB1
Product Type	Antibody
Gene ID (Entrez)	1499
Formulation	PBS with 0.5% BSA, 10% proprietary stabilizer and 0.05% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	15B8

5,775

Invitrogen™ CD16 Monoclonal Antibody (eBioCB16 (CB16)), Super Bright™ 702, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Super Bright 702
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	O75015, P08637
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	CD16
Gene Symbols	FCGR3A, FCGR3B
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	4833442P21Rik; CD16; CD16-2; CD16A; CD16a antigen; CD16b; CD32; CD32 receptor 2; CDw32; cytolytic trigger molecule G7; Fc fragment of IgG intermediate affinity IV receptor; Fc fragment of IgG low affinity IIIa receptor; Fc fragment of IgG receptor IIIa; Fc fragment of IgG receptor IIIb; Fc fragment of IgG, low affinity III, receptor for (CD16); Fc fragment of IgG, low affinity IIIa, receptor; Fc fragment of IgG, low affinity IIIa, receptor (CD16a); Fc fragment of IgG, low affinity IIIa, receptor for (CD16); Fc fragment of IgG, low affinity IIIa, receptor for (CD16); Fc fragment of IgG, low affinity III, receptor for (CD16); Fc fragment of IgG, low affinity IIIb, receptor (CD16b); Fc gamma receptor III; Fc gamma receptor IIIa; Fc gamma receptor III-A; Fc gamma receptor IIIb; Fc gamma RIIIa; Fc gammaRIV; Fc receptor, IgG, low affinity III; Fc receptor, IgG, low affinity IV; Fc receptor-like 3; Fcg receptor III; FCG2; FCG3; Fc-gamma receptor III-2 (CD 16); Fc-gamma receptor IIIb (CD 16); Fc-gamma receptor IIIb (CD16); Fc-gamma RII-b; Fc-gamma RII-c; fc-gamma RIII; Fc-gamma RIIIa; Fc-gamma RIII-alpha; fc-gamma RIIIb; fc-gamma RIII-beta; Fc-gamma-RIIb; Fc-gamma-RIIc; FcgammaRIII; FcgammaRIII a.1; FcgammaRIII a.2; FcgammaRIII a.3; FcgammaRIIIA; FcgammaRIV; FCGR2; FCGR2A; FCGR2B; FCGR2C; FCGR3; Fcgr3a; FCGR3B; Fcgr4; FCGRIII; FcgRIV; FcR-10; FcRII-b; FcRII-c; FcRIII; FCRIIIA; FCRIIIb; Fcrl3; IGFR3; IgG Fc gamma receptor III; igG Fc receptor III; IgG Fc receptor III-1; igG Fc receptor III-2; IMD20; immunoglobulin G Fc receptor III; LOC100911825; Low affinity immunoglobulin gamma Fc region receptor III; low affinity immunoglobulin gamma Fc region receptor III-A; Low affinity immunoglobulin gamma Fc region receptor III-B; low affinity immunoglobulin gamma Fc region receptor III-like; Low affinity immunoglobulin gamma Fc region receptor IV; neutrophil-specific antigen NA; RP11-5K23.1; transmembrane receptor FcgammaRIII-X
Gene	FCGR3A
Product Type	Antibody
Gene ID (Entrez)	2214, 2215
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	eBioCB16 (CB16)

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ CD54 (ICAM-1) Monoclonal Antibody (HA58), Functional Grade, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GPR176 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SPTLC2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD13 Monoclonal Antibody (R3-63) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CRB1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Human IgD Monoclonal Antibody (IA6-2), Brilliant Violet™ 786, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SOX5 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD105 (Endoglin) Monoclonal Antibody (SN6), Brilliant Violet™ 421, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TNF alpha Monoclonal Antibody (68B6A3 L1) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD54 (ICAM-1) Monoclonal Antibody (HA58), Functional Grade, eBioscience™

Invitrogen™ GPR176 Polyclonal Antibody

Invitrogen™ SPTLC2 Polyclonal Antibody

Invitrogen™ CD13 Monoclonal Antibody (R3-63)

Invitrogen™ CRB1 Polyclonal Antibody

Invitrogen™ Human IgD Monoclonal Antibody (IA6-2), Brilliant Violet™ 786, eBioscience™

Invitrogen™ SOX5 Polyclonal Antibody

Invitrogen™ CD105 (Endoglin) Monoclonal Antibody (SN6), Brilliant Violet™ 421, eBioscience™

Invitrogen™ TNF alpha Monoclonal Antibody (68B6A3 L1)