Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

1,231 – 1,245 of 1,806,396 results

1,231

Invitrogen™ FOXO3A Monoclonal Antibody (K.115.9)

Rabbit Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat,Monkey
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O43524, Q9WVH4
Isotype	IgG
Concentration	15 μg/mL
Antigen	FOXO3A
Gene Symbols	FOXO3
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	1110048B16Rik; 2010203A17Rik; AF6q21; AF6q21 protein; C76856; Fkhr2; FKHRL1; FKHRL1P2; forkhead box O3; forkhead box O3a; forkhead box O3A transcription factor; forkhead box protein O3; forkhead homolog (rhabdomyosarcoma) like 1; forkhead in rhabdomyosarcoma-like 1; forkhead protein FKHR2; forkhead, Drosophila, homolog of, in rhabdomyosarcoma-like 1; FOXO2; FOXO3; FOXO-3; FOXO3A
Gene	FOXO3
Product Type	Antibody
Gene ID (Entrez)	2309, 294515, 56484
Formulation	0.01M HEPES with 100μg/mL BSA, 50% glycerol, 0.15M NaCl and <0.02% sodium azide; pH 7.5
Immunogen	Synthetic peptide corresponding to residues surrounding Glu50 of human FoxO3a.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	K.115.9

1,232

Invitrogen™ Phospho-IRS1 (Tyr612) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P35568
Isotype	IgG
Antigen	Phospho-IRS1 (Tyr612)
Gene Symbols	IRS1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	G972R; HIRS-1; Insulin receptor substrate 1; IRS1; IRS-1; IRS1IRM; pp185
Gene	IRS1
Product Type	Antibody
Gene ID (Entrez)	3667
Formulation	Dulbecco's PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.3
Immunogen	The antiserum was produced against a chemically synthesized phosphopeptide derived from the region of human IRS-1 that contains tyrosine 612. The sequence is conserved in mouse, rat and chicken.
Classification	Polyclonal
Primary or Secondary	Primary

1,233

Invitrogen™ IL-1 beta Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P01584, P10749, Q63264
Isotype	IgG
Concentration	1 mg/mL
Antigen	IL-1 beta
Gene Symbols	IL1B
Regulatory Status	RUO
Purification Method	Affinity Chromatography
Gene Alias	catabolin; cytokine; Hematopoietin 1 (H1); IFN beta inducing factor; il 1b; IL 1β; IL-1; IL1 B; IL-1 beta; IL-1 precursor; IL1B; IL-1B; IL1B1; IL1beta; IL-1beta; IL1-BETA; IL1F2; IL1β; ILN; Interleukin; interleukin 1 beta; Interleukin 1 beta precursor; interleukin 1, beta; interleukin 1, beta 1; interleukin 1-beta; interleukin1beta; Interleukin1 beta; interleukin-1 beta; interleukin-1 beta precursor; interleukin-1 beta precursor (AA -113 to 153); interleukin-1 beta proprotein; interleukin-1b; interleukin-1beta; interleukin-beta; LAF; lymphocyte proliferation-potentiating factor; Osteoclast activating factor (OAF); preinterleukin 1 beta; Pro interleukin 1 beta; prointerleukin-1 beta; pro-interleukin-1-beta
Gene	IL1B
Product Type	Antibody
Gene ID (Entrez)	16176, 24494, 3553
Formulation	PBS with 50% glycerol and 0.09% sodium azide; pH 7.3
Immunogen	Recombinant protein (or fragment).
Classification	Polyclonal
Primary or Secondary	Primary

1,234

Invitrogen™ CD20 Recombinant Rabbit Monoclonal Antibody (SY12-01)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Monkey
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P11836
Isotype	IgG
Concentration	1 mg/mL
Antigen	CD20
Gene Symbols	Ms4a1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	AA960661; APY; ATOPY; B1; B-cell differentiation antigen Ly-44; B-lymphocyte antigen CD20; B-lymphocyte cell-surface antigen B1; B-lymphocyte surface antigen B1; Bp35; Cd20; CD20 antigen; CD20 cell surface protein; CD20 receptor; CVID5; EGK_06167; Fc epsilon receptor I beta chain; Fc Fragment of IgE high affinity I receptor for beta polypeptide; FCER1B; High affinity immunoglobulin epsilon receptor subunit beta; IgE Fc receptor subunit beta; IGEL; IGER; IGHER; LEU16; LEU-16; Leukocyte surface antigen Leu-16; Ly44; Ly-44; Lymphocyte antigen 44; membrane spanning 4-domains A1; membrane-spanning 4-domains subfamily A member 1; membrane-spanning 4-domains, subfamily A, member 1; membrane-spanning 4-domains, subfamily A, member 2; MGC3969; MS4A1; MS4A2; S7
Gene	Ms4a1
Product Type	Antibody
Gene ID (Entrez)	931
Formulation	TBS with 0.05% BSA, 40% Glycerol and 0.05% sodium azide; pH 7.4
Immunogen	Synthetic peptide within Human CD20 aa 248-297.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	SY12-01

1,235

Invitrogen™ PSMB8 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P28062
Isotype	IgG
Concentration	1 mg/mL
Antigen	PSMB8
Gene Symbols	Psmb8
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	ALDD; D6S216; D6S216E; DAAP-57C1.3; JMP; large multifunctional protease 7; Lmp7; Lmp-7; low molecular mass polypeptide 7; low molecular mass protein 7; low molecular weight protein 7; macropain subunit C13; Mc13; MC13 (LMP7); MGC1491; multicatalytic endopeptidase complex subunit C13; NKJO; OTTHUMP00000029420; OTTHUMP00000029421; OTTHUMP00000062981; protease component C13; proteasome (prosome, macropain) subunit, beta type 8 (large multifunctional peptidase 7); proteasome (prosome, macropain) subunit, beta type, 8; proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7); proteasome catalytic subunit 3i; proteasome component C13; proteasome subunit beta 5i; proteasome subunit beta 8; proteasome subunit beta type 8; proteasome subunit beta type-8; Proteasome subunit beta-5i; proteasome subunit MC13; proteasome subunit Y2; proteasome-related gene 7; proteosome (prosome, macropain) subunit, beta type 8 (large multifunctional peptidase 7); proteosome beta 8 subunit; PSMB5i; Psmb8; Really interesting new gene 10 protein; Ring10; Y2
Gene	Psmb8
Product Type	Antibody
Gene ID (Entrez)	5696
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic Peptide: C V(259) E S T D V S D L L H Q Y R E A(274).
Classification	Polyclonal
Primary or Secondary	Primary

1,236

Invitrogen™ NKp46 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O76036, Q8C567, Q9Z0H5
Isotype	IgG
Concentration	1 mg/mL
Antigen	NKp46
Gene Symbols	NCR1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	1-Mar; activating receptor 1; Ar1; CD335; hNKp46; Kilr1; KILR-1; LY94; Ly-94; lymphocyte antigen 94; Lymphocyte antigen 94 homolog; lymphocyte antigen 94 homolog (activating NK-receptor; lymphocyte antigen 94 homolog (activating NK-receptor; NK-p46); mAR-1; MAR1 (mouse activating receptor 1); mNKp46; natural cytotoxicity triggering receptor 1; Natural killer cell p46-related protein; natural killer cell receptor; Ncr1; NK cell-activating receptor; NK receptor KILR-1; NKACTR; Nkp46; NK-p46; NK-p46); rAR-1; rat-activating receptor 1
Gene	NCR1
Product Type	Antibody
Gene ID (Entrez)	117547, 17086, 9437
Formulation	PBS with 50% glycerol and 0.02% sodium azide; pH 7.4
Immunogen	A synthesized peptide derived from human NCR1(Accession O76036), corresponding to amino acid residues C144-Y194.
Classification	Polyclonal
Primary or Secondary	Primary

1,237

Invitrogen™ CD41 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P08514, Q9QUM0
Isotype	IgG
Concentration	500 μg/mL
Antigen	CD41
Gene Symbols	Itga2b
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI172977; alpha IIb; alphaIIb; alphaIIb protein; BDPLT16; BDPLT2; CD41; CD41B; form 1; form 2; GP IIb; GP2B; GPalpha IIb; GPIIb; GT; GTA; HPA3; integrin alpha 2b; integrin alpha 2b (Cd41b); integrin alpha-IIb; Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain; Integrin alpha-IIb light chain, form 1; Integrin alpha-IIb light chain, form 2; integrin subunit alpha 2b; integrin subunit alpha IIb; integrin, alpha 2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); ITGA2B; ITGAB; platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb; platelet glycoprotein IIb of IIb/II Ia complex; platelet glycoprotein IIb of IIb/IIIa complex; platelet membrane glycoprotein IIb; platelet-specific antigen BAK; PPP1R93; protein phosphatase 1, regulatory subunit 93
Gene	Itga2b
Product Type	Antibody
Gene ID (Entrez)	16399, 3674, 685269
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN).
Classification	Polyclonal
Primary or Secondary	Primary

1,238

Invitrogen™ Bcl-2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat,Zebrafish
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P10415, P10417, P49950
Isotype	IgG
Concentration	0.2 mg/mL
Antigen	Bcl-2
Gene Symbols	Bcl2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	apoptosis regulator Bcl-2; AW986256; B cell leukemia/lymphoma 2; B cell lymphoma 2 associated oncogene; B-cell CLL/lymphoma 2; B-cell leukemia/lymphoma 2; Bcl 2; BCL2; bcl-2; BCL2 apoptosis regulator; Bcl-2 protein; BCL2, apoptosis regulator; Bcl2-like protein; C430015F12Rik; D630044D05Rik; D830018M01Rik; OTTHUMP00000163680; PPP1R50; protein phosphatase 1, regulatory subunit 50
Gene	Bcl2
Product Type	Antibody
Gene ID (Entrez)	12043, 24224, 596
Formulation	PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Carrier-protein conjugated synthetic peptide encompassing a sequence within the N-terminus region of human Bcl-2. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

1,239

Invitrogen™ VWF Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	Q62935, Q8CIZ8
Isotype	IgG
Concentration	500 μg/mL
Antigen	VWF
Gene Symbols	VWF
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	6820430P06Rik; AI551257; B130011O06Rik; C630030D09; Coagulation Factor VIII; coagulation factor VIII VWF; EMBL:CAB37852.1}; F8VWF; factor viii related antigen; von Willebrand antigen 2; von Willebrand antigen II; von Willebrand Disease (vWD); von Willebrand factor; Von Willebrand factor homolog; VWD; vwf; vwf {ECO:0000312
Gene	VWF
Product Type	Antibody
Gene ID (Entrez)	116669, 22371
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	E.coli-derived mouse VWF recombinant protein (Position: M1304-E1452).
Classification	Polyclonal
Primary or Secondary	Primary

1,240

Invitrogen™ CD55 Monoclonal Antibody (BRIC-216)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunoprecipitation,Neutralization,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P08174
Isotype	IgG1
Concentration	1 mg/mL
Antigen	CD55
Gene Symbols	CD55
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	CD55; CD55 antigen; CD55 molecule (Cromer blood group); CD55 molecule, decay accelerating factor for complement; CD55 molecule, decay accelerating factor for complement (Cromer blood group); Cd55a; Complement decay-accelerating factor; complement decay-accelerating factor, GPI-anchored; complement-glycosylphosphatidylinositol; CR; CROM; Cromer blood group; Daf; Daf1; DAF-GPI; decay accelarating factor 1; decay accelerating factor 1; decay accelerating factor GPI-form; decay-accelarating factor; glycosylphophatidylinositol-anchored form; GPI anchor addition signal; GPI-DAF; RP11-357P18.1; TC
Gene	CD55
Product Type	Antibody
Gene ID (Entrez)	1604
Formulation	TBS with 0.09% sodium azide
Immunogen	Human fibroblast cell line.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	BRIC-216

1,241

Invitrogen™ VCAM-1 (CD106) Recombinant Rabbit Monoclonal Antibody (SA05-04)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat,Zebrafish
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P19320, P29533, P29534
Isotype	IgG
Concentration	1.07 mg/mL
Antigen	VCAM-1 (CD106)
Gene Symbols	VCAM1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	adhesion molecule VCAM-1; CD106; CD106 antigen; DKFZp779G2333; INCAM100; INCAM-100; MGC99561; sCD106; soluble CD106; soluble VCAM 1; sVCAM 1; vascular cell adhesion molecule; vascular cell adhesion molecule 1; vascular cell adhesion molecule-1; vascular cell adhesion protein 1; V-CAM 1; Vcam1; Vcam-1; VCAM1B
Gene	VCAM1
Product Type	Antibody
Gene ID (Entrez)	22329, 25361, 7412
Formulation	PBS with 0.1% BSA, 40% Glycerol and 0.2% ProClin 950; pH 7.4
Immunogen	Synthetic peptide within Human VCAM1 aa 690-739.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	SA05-04

1,242

Invitrogen™ IL17RA Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Western Blot
Form	Liquid
Gene Accession No.	Q60943, Q96F46
Isotype	IgG
Concentration	1 mg/mL
Antigen	IL17RA
Gene Symbols	Il17ra
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AW538159; CANDF5; CD127; CD217; CDw217; hIL-17R; IL-17 receptor A; IL17R; Il17ra; IL-17RA; interleukin 17 receptor A; interleukin-17 receptor A; MGC10262; VDw217
Gene	Il17ra
Product Type	Antibody
Gene ID (Entrez)	16172, 23765
Formulation	PBS with 0.02% sodium azide
Immunogen	An 18 amino acid peptide near the amino terminus of human IL-17RA.
Classification	Polyclonal
Primary or Secondary	Primary

1,243

Invitrogen™ Phospho-p38 MAPK (Thr180, Tyr182) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P70618, Q16539
Isotype	IgG
Antigen	Phospho-p38 MAPK (Thr180, Tyr182)
Gene Symbols	MAPK14
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	186F5S; anon-sts23; BG:DS00797.3; CG7393; CG7393-PA; CRK1; CSAID-binding protein; Csaids binding protein; CSBP; Csbp1; Csbp2; CSPB1; cytokine suppressive anti-inflammatory drug binding protein; cytokine suppressive anti-inflammatory drug binding protein 1; cytokine suppressive anti-inflammatory drug-binding protein; cytokine-supressive anti-inflammatory drug binding protein; Dm p38b; Dmel\CG7393; Dmel_CG7393; Dmp38b; Dp38; D-p38; D-p38 MAPK; Dp38b; D-p38b; EC 2.7.11.24; ERK1; ERT2; ESTS:186F5S; etID18993.8; Exip; fk28c03; hm:zeh1243; Hog; I79_016605; LD24658p; MAP 14; MAP kinase 1; MAP kinase 11; MAP kinase 14; MAP kinase 14A; MAP kinase 2; MAP kinase Mxi2; MAP kinase p38; MAP kinase p38 alpha; MAP kinase p38 beta; MAP kinase p38a; MAP kinase p38alpha; MAP kinase p38b; MAPK; MAPK 11; MAPK 14; MAPK 14A; MAPK1 antibody; Mapk11; Mapk14; mapk14a; MAX-interacting protein 2; mitogen activated protein kinase 11; mitogen activated protein kinase 14; mitogen-activated protein kinase 11; Mitogen-activated protein kinase 14; mitogen-activated protein kinase 14a; Mitogen-activated protein kinase p38 alpha; mitogen-activated protein kinase p38 beta; mitogen-activated protein kinase p38-2; mitogen-activated protein kinase p38a; Mitogen-activated protein kinase p38b; MK14; Mpk34C; Mxi2; OTTHUMP00000216563; OTTHUMP00000216566; P38; p38 alpha; p38 alpha/Mxi2; p38 beta; p38 MAP kinase; p38 MAP kinase alpha; p38 MAPK; p38 mitogen activated protein kinase; p38 mitogen-activated protein kinase; p38-2; p38a; p38ALPHA; p38-alpha; p38alpha Exip; P38B; p38b MAP kinase; p38beta; p38beta2; p38b-PA; p38Hog; p38Kb; p38MAPK; PRKM11; Prkm14; Prkm15; protein kinase, mitogen activated kinase, 11, p38beta; reactive kinase; RK; RP1-179N16.5; Sapk2; Sapk2A; SAPK2b; stress-activated p38b MAP kinase; stress-activated protein kinase 2A; Stress-activated protein kinase 2b; stress-activated protein kinase-2; stress-activated protein kinase-2b; tRNA synthetase cofactor p38; wu:fk28c03; zeh1243; zp38a
Gene	MAPK14
Product Type	Antibody
Gene ID (Entrez)	1432, 81649
Formulation	Dulbecco's PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.3
Immunogen	The antiserum was produced against a chemically synthesized phosphopeptide derived from the region of human p38 that contains threonine 180 and tyrosine 182. This region is conserved among many species including mouse, rat, dog, monkey and carp.
Classification	Polyclonal
Primary or Secondary	Primary

1,244

Invitrogen™ Phospho-Tau (Ser356) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	P10636, P10637, P19332
Isotype	IgG
Antigen	Phospho-Tau (Ser356)
Gene Symbols	MAPT
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI413597; AW045860; DDPAC; FLJ31424; FTDP17; FTDP-17; G protein beta1/gamma2 subunit-interacting factor 1; map tau; Mapt; MAPTL; MGC138549; microtubule associated protein tau; microtubule-associated protein tau; microtubule-associated protein tau, isoform 4; microtubules; MSTD; Mtapt; MTBT1; MTBT2; Neurofibrillary tangle protein; neurofibrillary tangles; Neuronal Marker; paired helical filament-tau; PHFtau; PHF-tau; PPND; PPP1R103; protein phosphatase 1, regulatory subunit 103; pTau; RNPTAU; Tau; Tau microtubule-associated protein; tau protein; Tau-4; Tau5; Unknown (protein for MGC:134287)
Gene	MAPT
Product Type	Antibody
Gene ID (Entrez)	17762, 29477, 4137
Formulation	Dulbecco's PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.3
Immunogen	The antiserum was produced against a chemically synthesized phosphopeptide derived from a region of human Tau that contains serine 356. The sequence is conserved in many species including mouse, rat, rhesus monkey, baboon, cow and goat.
Classification	Polyclonal
Primary or Secondary	Primary

1,245

Invitrogen™ TIMP1 Monoclonal Antibody (F31 P2 A5)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rhesus Macaque
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P01033, P12032, Q95KL9
Isotype	IgG1
Concentration	1 mg/mL
Antigen	TIMP1
Gene Symbols	TIMP1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	CLGI; collagenase inhibitor; Collagenase inhibitor 16C8 fibroblast; EG-1; Embryogenin-1; EPA; EPO; erythroid potentiating activity; erythroid-potentiating activity; Fibroblast collagenase inhibitor; FLJ90373; HCI; Metalloproteinase inhibitor; metalloproteinase inhibitor 1; metalloproteinase tissue inhibitor; metalloproteinase tissue inhibitor 1; MMP inhibitor; RP1-230G1.3; Timp; TIMP 1; TIMP metallopeptidase inhibitor 1; TIMP1; TIMP-1; TIMP-1 protein; tissue inhibitor of matrix metalloproteinase-1; tissue inhibitor of metal proteinases; tissue inhibitor of metallopeptidase 1; tissue inhibitor of metalloproteinase; tissue inhibitor of metalloproteinase 1; tissue inhibitor of metalloproteinase 1 (erythroid potentiating activity, collagenase inhibitor); tissue inhibitor of metalloproteinase-1; tissue inhibitor of metalloproteinases; tissue inhibitor of metalloproteinases 1; TPA-induced protein; TPA-S1
Gene	TIMP1
Product Type	Antibody
Gene ID (Entrez)	21857, 574348, 7076
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic peptide corresponding to residues F(72) Q A L G D A A D I R(82) of mouse TIMP-1.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	F31 P2 A5

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ FOXO3A Monoclonal Antibody (K.115.9) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Phospho-IRS1 (Tyr612) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ IL-1 beta Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD20 Recombinant Rabbit Monoclonal Antibody (SY12-01) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PSMB8 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NKp46 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD41 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Bcl-2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ VWF Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD55 Monoclonal Antibody (BRIC-216) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ VCAM-1 (CD106) Recombinant Rabbit Monoclonal Antibody (SA05-04) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ IL17RA Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Phospho-p38 MAPK (Thr180, Tyr182) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Phospho-Tau (Ser356) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TIMP1 Monoclonal Antibody (F31 P2 A5) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ FOXO3A Monoclonal Antibody (K.115.9)

Invitrogen™ Phospho-IRS1 (Tyr612) Polyclonal Antibody

Invitrogen™ IL-1 beta Polyclonal Antibody

Invitrogen™ CD20 Recombinant Rabbit Monoclonal Antibody (SY12-01)

Invitrogen™ PSMB8 Polyclonal Antibody

Invitrogen™ NKp46 Polyclonal Antibody

Invitrogen™ CD41 Polyclonal Antibody

Invitrogen™ Bcl-2 Polyclonal Antibody

Invitrogen™ VWF Polyclonal Antibody

Invitrogen™ CD55 Monoclonal Antibody (BRIC-216)

Invitrogen™ VCAM-1 (CD106) Recombinant Rabbit Monoclonal Antibody (SA05-04)

Invitrogen™ IL17RA Polyclonal Antibody

Invitrogen™ Phospho-p38 MAPK (Thr180, Tyr182) Polyclonal Antibody

Invitrogen™ Phospho-Tau (Ser356) Polyclonal Antibody

Invitrogen™ TIMP1 Monoclonal Antibody (F31 P2 A5)