All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (7)
- (2)
- (3,051)
- (901)
- (1,756)
- (4,347)
- (1)
- (1)
- (3)
- (1)
- (1,205)
- (1,717)
- (803,432)
- (21,372)
- (2)
- (752)
- (60)
- (1)
- (29)
- (5,029)
- (3,330)
- (1,831)
- (213)
- (1)
- (8,787)
- (11,941)
- (2,264)
- (4)
- (1)
- (13)
- (67)
- (5)
- (1)
- (2,890)
- (3,906)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (13)
- (2,591)
- (466)
- (1)
- (1)
- (136)
- (236)
- (3)
- (1)
- (13)
- (95)
- (1)
- (166,039)
- (202,261)
- (1)
- (22)
- (798)
- (2)
- (11,004)
- (1)
- (123)
- (2)
- (4)
- (11)
- (4)
- (9)
- (1)
- (2)
- (5)
- (34)
- (3)
- (1)
- (4)
- (1)
- (108)
- (1)
- (20)
- (11)
- (19)
- (5)
- (1)
- (1)
- (10,786)
- (587)
- (1)
- (2)
- (1)
- (9)
- (2)
- (2)
- (321)
- (360)
- (5)
- (13,657)
- (2)
- (4,709)
- (2,250)
- (1)
- (14)
- (1)
- (1)
- (7)
- (5,614)
- (3,967)
- (1)
- (18)
- (1)
- (1)
- (2)
- (17,459)
- (16,736)
- (25)
- (1)
- (1)
- (2)
- (5,499)
- (1)
- (32)
- (4)
- (13)
- (76)
- (578)
- (17)
- (2)
- (1)
- (1)
- (1)
- (2,083)
- (1)
- (14)
- (3)
- (1)
- (1)
- (2)
- (7)
- (2)
- (2)
- (104)
- (1)
- (3,883)
- (2)
- (20)
- (3)
- (108)
- (1)
- (5)
- (1)
- (1)
- (5)
- (194)
- (2)
- (4,819)
- (11)
- (2)
- (5)
- (9)
- (4)
- (2)
- (23)
- (110)
- (7,552)
- (35,272)
- (1,381)
- (53)
- (1,544)
- (21)
- (7)
- (1)
- (2,047)
- (1)
- (4,336)
- (41)
- (2)
- (1)
- (1)
- (4)
- (37)
- (1)
- (1)
- (684)
- (1)
- (1)
- (2)
- (4)
- (6)
- (3)
- (6)
- (1)
- (1)
- (81)
- (105)
- (703,617)
- (5)
- (11)
- (684,478)
- (32,340)
- (55)
- (547)
- (3)
- (565)
- (2,591)
- (38)
- (1)
- (15)
- (1,621)
- (726)
- (2)
- (2)
- (6)
- (4)
- (5)
- (93,518)
- (62)
- (116)
- (1,915)
- (14,453)
- (187)
- (8)
- (23)
- (511,423)
- (12)
- (1)
- (683,252)
- (72,369)
- (3)
- (37,909)
- (169)
- (1)
- (1)
- (28,754)
- (9)
- (1)
- (25)
- (2,809)
- (74)
- (89)
- (275)
- (2)
- (51)
- (29,171)
- (28,696)
- (6)
- (29,915)
- (16)
- (28,969)
- (45)
- (93)
- (48)
- (29,227)
- (1)
- (29,798)
- (1)
- (3)
- (1)
- (73)
- (29,180)
- (29,171)
- (149)
- (121)
- (36)
- (174)
- (23)
- (125)
- (5)
- (103)
- (106)
- (2)
- (1)
- (92)
- (6)
- (15)
- (5)
- (33,278)
- (11)
- (3)
- (223)
- (764)
- (1,057)
- (715)
- (767)
- (909)
- (879)
- (1,007)
- (844)
- (1,482)
- (911)
- (830)
- (1,049)
- (1,049)
- (1,050)
- (675)
- (1,080)
- (30,339)
- (102)
- (15)
- (47)
- (18)
- (1)
- (147)
- (1)
- (175)
- (3)
- (122)
- (27,698)
- (27,745)
- (28,123)
- (63)
- (27,765)
- (23,764)
- (1)
- (60)
- (27,690)
- (27,340)
- (27,301)
- (17)
- (9)
- (1)
- (1)
- (7)
- (5)
- (31,814)
- (5)
- (30)
- (1)
- (1)
- (338)
- (735)
- (28,717)
- (1)
- (30,788)
- (25,917)
- (17,685)
- (17,678)
- (25,900)
- (30,790)
- (38)
- (1)
- (46)
- (9)
- (12)
- (2)
- (103)
- (11)
- (22)
- (58)
- (26)
- (132)
- (171)
- (25)
- (90)
- (58)
- (14)
- (56)
- (74)
- (9)
- (78)
- (83)
- (99)
- (88)
- (90)
- (16)
- (64)
- (66)
- (42)
- (58)
- (50)
- (53)
- (108)
- (134)
- (41)
- (68)
- (65)
- (88)
- (73)
- (454)
- (30,080)
- (7)
- (4)
- (312)
- (387)
- (2,717)
- (3,642)
- (2)
- (3)
- (36)
- (213)
- (2,606)
- (94)
- (31)
- (26,319)
- (514)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (868)
- (146)
- (795)
- (824)
- (418)
- (342)
- (803)
- (35)
- (712)
- (2)
- (716)
- (780)
- (743)
- (778)
- (629)
- (763)
- (12)
- (29)
- (116)
- (5)
- (274)
- (250)
- (125)
- (126)
- (95)
- (46)
- (12)
- (5)
- (5)
- (9)
- (3)
- (8)
- (2)
- (64)
- (14)
- (474,785)
- (7)
- (266)
- (49)
- (2)
- (367)
- (68)
- (47)
- (25)
- (270)
- (3)
- (3)
- (4)
- (29,299)
- (29,325)
- (29,280)
- (2)
- (20)
- (23)
- (114)
- (830)
- (442)
- (93)
- (2)
- (1,046)
- (2)
- (3)
- (4)
- (3)
- (126)
- (13)
- (5)
- (1)
- (6,753)
- (1,594)
- (1)
- (27)
- (4)
- (22)
- (64)
- (2)
- (7,464)
- (41)
- (309)
- (173)
- (609)
- (157)
- (6)
- (301)
- (2)
- (12)
- (14)
- (27)
- (53)
- (1)
- (1)
- (284)
- (55)
- (21)
- (68,167)
- (2)
- (1)
- (54)
- (79)
- (238)
- (175)
- (3,224)
- (3)
- (2)
- (1,453)
- (38)
- (381,736)
- (14,813)
- (14,347)
- (10,131)
- (60)
- (16)
- (25)
- (524)
- (9)
- (2)
- (2)
- (2)
- (6)
- (2)
- (285,004)
- (946)
- (14,014)
- (39)
- (11)
- (6)
- (1)
- (1)
- (4)
- (105)
- (2)
- (13,335)
- (37)
- (2)
- (1)
- (2)
- (175)
- (605)
- (10,006)
- (116)
- (30)
- (2)
- (2)
- (7)
- (270)
- (3)
- (2)
- (2)
- (10)
- (23)
- (64)
- (92)
- (2,641)
- (2,462)
- (222,966)
- (85,269)
- (173)
- (53)
- (177,993)
- (409,900)
- (77)
- (1,066)
- (33,224)
- (10)
- (99)
- (12,808)
- (382,786)
- (93)
- (245)
- (531)
- (120,578)
- (1,044)
- (26)
- (11)
- (51)
- (304)
- (22)
- (274)
- (687)
- (478)
- (1)
- (1,171)
- (2)
- (26)
- (6,228)
- (1)
- (698)
- (31)
- (8)
- (130)
- (4)
- (3)
- (326)
- (9)
- (931)
- (1)
- (2)
- (1,074)
- (81)
- (198)
- (8)
- (6)
- (34,742)
- (1)
- (868)
- (41)
- (1,666)
- (1,226)
- (2)
- (8,929)
- (2)
- (1)
- (869)
- (4)
- (125)
- (2)
- (1)
- (1,754)
- (70)
- (7)
- (19)
- (1,246)
- (1)
- (1,882)
- (819)
- (665)
- (41)
- (2,649)
- (2)
- (468)
- (207)
- (29)
- (14)
- (21)
- (11)
- (2,119)
- (211)
- (1)
- (1)
- (1)
- (29)
- (34)
- (2)
- (1)
- (1)
- (927,776)
- (3)
- (4,261)
- (19)
- (1)
- (22)
Filtered Search Results
Invitrogen™ Synaptophysin Monoclonal Antibody (SP11)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P07825, P08247, Q62277 |
| Isotype | IgG |
| Concentration | Conc. Not Determined |
| Antigen | Synaptophysin |
| Gene Symbols | Syp |
| Regulatory Status | RUO |
| Gene Alias | A230093K24Rik; AI848995; BM89 antigen; I79_012252; Major synaptic vesicle protein p38; MRX96; MRXSYP; p38; Syn; Synaptophysin; Syp; Syp I; Syp1 |
| Gene | Syp |
| Product Type | Antibody |
| Gene ID (Entrez) | 20977, 24804, 6855 |
| Formulation | Tissue culture supernatant, TBS with 1% BSA and 0.1% sodium azide; pH 7.5 |
| Immunogen | A synthetic peptide of human synaptophysin (aa 250-313). |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | SP11 |
CD11c Monoclonal Antibody (N418), Alexa Fluor™ 532, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Armenian Hamster Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Armenian Hamster |
| Conjugate | Alexa Fluor 532 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG |
| Gene Accession No. | Q9QXH4 |
| Concentration | 0.2 mg/mL |
| Antigen | CD11c |
| Gene Symbols | Itgax |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | AI449405; CD11 antigen-like family member C; CD11c; CD11C (p150) alpha polypeptide; complement component 3 receptor 4 subunit; complement receptor 4; Cr4; integrin alpha X; integrin alpha-X; integrin aX; integrin subunit alpha X; integrin, alpha X; integrin, alpha X (antigen CD11C (p150), alpha polypeptide); integrin, alpha X (complement component 3 receptor 4 subunit); Itgax; Leu M5; leu M5, alpha subunit; leukocyte adhesion glycoprotein p150,95 alpha chain; Leukocyte adhesion receptor p150,95; leukocyte surface antigen p150,95, alpha subunit; myeloid membrane antigen, alpha subunit; N418; p150 95 integrin alpha chain; RGD1561123; SLEB6 |
| Gene | Itgax |
| Product Type | Antibody |
| Gene ID (Entrez) | 16411 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | N418 |
Invitrogen™ Phospho-Tau (Thr181) Monoclonal Antibody (AT270)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunohistochemistry (Paraffin),Western Blot |
| Form | Liquid |
| Gene Accession No. | P10636 |
| Isotype | IgG1 κ |
| Concentration | 0.2 mg/mL |
| Antigen | Phospho-Tau (Thr181) |
| Gene Symbols | MAPT |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | AI413597; AW045860; DDPAC; FLJ31424; FTDP17; FTDP-17; G protein beta1/gamma2 subunit-interacting factor 1; map tau; Mapt; MAPTL; MGC138549; microtubule associated protein tau; microtubule-associated protein tau; microtubule-associated protein tau, isoform 4; microtubules; MSTD; Mtapt; MTBT1; MTBT2; Neurofibrillary tangle protein; neurofibrillary tangles; Neuronal Marker; paired helical filament-tau; PHFtau; PHF-tau; PPND; PPP1R103; protein phosphatase 1, regulatory subunit 103; pTau; RNPTAU; Tau; Tau microtubule-associated protein; tau protein; Tau-4; Tau5; Unknown (protein for MGC:134287) |
| Gene | MAPT |
| Product Type | Antibody |
| Gene ID (Entrez) | 4137 |
| Formulation | PBS with no preservative |
| Immunogen | Partially purified human PHF-Tau. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | AT270 |
Invitrogen™ H3K9ac Monoclonal Antibody (J.924.2)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Monoclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human,Mouse,Monkey,Rat,Zebrafish |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry,Western Blot |
| Form | Liquid |
| Gene Accession No. | P68431, P68433, P84228, Q71DI3 |
| Isotype | IgG |
| Concentration | 41 μg/mL |
| Antigen | H3K9ac |
| Gene Symbols | H3C1, H3C10, H3C12, H3C14, H3C15, H3C2, H3C7, h3f3b.1 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | Acetyl H3; Acetyl Histone H3; Acetyl-H3 K9; Acetyl-H3 Lys9; Acetyl-Histone H3 K9; Acetyl-Histone H3 Lys9; B0035.7; BUR5; CELE_T10C6.12; CG31613; CG31613-PA; CG33803; CG33806; CG33809; CG33812; CG33815; CG33818; CG33821; CG33824; CG33827; CG33830; CG33833; CG33836; CG33839; CG33842; CG33845; CG33848; CG33851; CG33854; CG33857; CG33860; CG33863; CG33866; Dmel\CG31613; Dmel_CG31613; F07B7.10; F07B7.3; F08G2.2; F17E9.13; F35H10.1; F45F2.4; F54E12.5; F55G1.10; H02I12.7; H3; H3 histone; H3 histone family, member A; H3 histone family, member I; H3 histone family, member K; H3 histone family, member L; H3 histone family, member M; H3 histone, family 2; H3 histone, family 3A; H3 histone, family 3B; H3 histone, family 3B (H3.3B); H3 histone, family 3B.1; H3 histone, family 3C; H3 K9ac; H3.1-221; H3.1-291; H3.1-I; H3.2; H3.2-221; H3.2-614; H3.2-615; H3.2-616; h3.2a; H3.3A; H3.3B; H3.5; H3/A; H3/b; H3/d; H3/f; H3/i; H3/j; H3/k; H3/l; H3/M; H3/n; H3/o; H3-143; H3-291; H3-3A; H3-3B; h3-5; H3-53; H3-614; H3a; H3b; H3-B; H3C1; H3c10; H3c11; H3C12; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3f; H3-F; H3F1K; H3F2; H3F3; H3F3A; H3F3B; h3f3b.1; H3F3C; h3f3d; H3FA; H3FB; H3FC HIST1H3C; H3FD; H3FF; H3FH; H3FI; H3FJ; H3FK; H3FL; H3FM; H3FN; H3g; H3h; H3i; H3K9; H3Lys9ac; h3r; HHT1; HHT2; his-12; his-16; his-19; his-21; His3; his-3; His3:CG31613; His3:CG31613-PA; His3:CG33803; His3:CG33806; His3:CG33809; His3:CG33812; His3:CG33815; His3:CG33818; His3:CG33821; His3:CG33824; His3:CG33827; His3:CG33830; His3:CG33833; His3:CG33836; His3:CG33839; His3:CG33842; His3:CG33845; His3:CG33848; His3:CG33851; His3:CG33854; His3:CG33857; His3:CG33860; His3:CG33863; His3:CG33866; his-30; his-33; his-43; his-47; his-51; his-53; his-57; his-61; his-65; his-68; his-7; Hist1; HIST1H3A; HIST1H3B; Hist1h3c; HIST1H3D; HIST1H3E; Hist1h3f; hist1h3g; hist1h3g.L; HIST1H3H; Hist1h3i; HIST1H3J; hist2h3; HIST2H3A; Hist2h3b; HIST2H3C; Hist2h3c1; Hist2h3c2; Hist2h3c2-ps; Hist2h3ca1; Hist2h3ca2; HIST2H3D; histone 1, H3a; histone 1, H3b; histone 1, H3f; histone 1, H3h; histone 2, H3a; histone 2, H3c; histone 2, H3c2; histone 2, H3ca2; Histone 3; histone cluster 1, H3a; histone cluster 1, H3b; histone cluster 1, H3f; histone cluster 1, H3g protein L homeolog; histone cluster 1, H3h; histone cluster 2, H3a; histone cluster 2, H3c; histone cluster 2, H3c2; histone cluster 2, H3c2, pseudogene; histone gene complex 1; Histone H2A; Histone H3; histone H3.1; Histone H3.2; histone H3.3; histone H3.3A; histone H3.3C; Histone H3.5; histone H3/a; Histone H3/b; Histone H3/c; Histone H3/d; Histone H3/f; Histone H3/h; Histone H3/i; Histone H3/j; Histone H3/k; histone H3/l; Histone H3/m; histone H3/o; Histone H3K9; Histone H3K9ac; histone variant H3.5; hypothetical protein LOC550262; K06C4.11; K06C4.3; M32461; N2749; PP781; SIN2; T10C6.12; T23D8.6; wu:fa25h06; wu:fa96g06; wu:fb07a08; wu:fb36f01; XELAEV_18028537mg; YBR010W; YBR0201; YNL031C; zgc:110292; zgc:174300; zgc:56193; zgc:56418; zgc:64222; zgc:86731; ZK131.10; ZK131.6 |
| Gene | H3C15 |
| Product Type | Antibody |
| Gene ID (Entrez) | 126961, 260423, 291159, 310678, 319150, 319152, 333932, 360198, 550262, 679994, 8350, 8356, 8357, 8358, 8968, 97114 |
| Formulation | 0.01M HEPES with 50% glycerol, 0.15M NaCl, 100 μg/mL BSA and <0.02% sodium azide; pH 7.5 |
| Immunogen | Synthetic peptide corresponding to the amino terminus of histone H3 in which Lys9 is acetylated. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | J.924.2 |
Invitrogen™ Synaptophysin Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human,Mouse,Rat,Bovine,Sheep |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P07825, P08247, P20488, Q62277 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | Synaptophysin |
| Gene Symbols | Syp |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | A230093K24Rik; AI848995; BM89 antigen; I79_012252; Major synaptic vesicle protein p38; MRX96; MRXSYP; p38; Syn; Synaptophysin; Syp; Syp I; Syp1 |
| Gene | Syp |
| Product Type | Antibody |
| Gene ID (Entrez) | 101112034, 20977, 24804, 280937, 6855 |
| Formulation | PBS with 1mg/mL BSA and 0.05% sodium azide |
| Immunogen | Synthetic peptide corresponding to residues G(253) P G G Y G P Q D S Y G P Q G G Y Q P D(272) of rat Synaptophysin. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ Cirevetmab Recombinant Canine Monoclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Canine Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Canine |
| Host Species | Canine |
| Conjugate | Unconjugated |
| Applications | ELISA,Flow Cytometry,Functional Assay |
| Form | Liquid |
| Isotype | IgG2 κ |
| Concentration | 1 mg/mL |
| Antigen | Cirevetmab |
| Regulatory Status | RUO |
| Purification Method | Protein A/G |
| Gene Alias | CAS:2473240-98-9; ZTS00521426; ZTS-00521426 |
| Product Type | Antibody |
| Formulation | PBS with no preservative; pH 7.4 |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
Herpes Simplex Virus Type-1, Goat, FITC, Polyclonal Antibody, Abnova™
Goat polyclonal antibody raised against Herpes Simplex Virus Type-1.
Integrin alpha V beta 6 Antibody (STX-100) [Alexa Fluor™ 405] - (Research Grade Biosimilar), Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Human Monoclonal Antibody
| Content And Storage | Store at 4°C in the dark. |
|---|---|
| Target Species | Human |
| Host Species | Human |
| Conjugate | Alexa Fluor 405 |
| Applications | Flow Cytometry,ELISA,Functional Assay |
| Form | Purified |
| Isotype | IgG1 |
| Research Discipline | Cancer, Cardiovascular Biology, Cellular Signaling, Stem Cells |
| Antigen | Integrin alpha V beta 6 |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Gene Alias | CD51, integrin subunit alpha V, ITGAV, MSK8, VNRA, VTNR |
| Gene ID (Entrez) | 3685 |
| Formulation | 50mM Sodium Borate |
| Classification | Monoclonal |
| Immunogen | Integrin aVb6 (ITGAV & ITGB6) |
| Primary or Secondary | Primary |
| Clone | STX-100 |
COX15 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot |
| Form | Purified |
| Isotype | IgG |
| Gene Accession No. | Q7KZN9-2 |
| Concentration | 1 mg/ml |
| Antigen | COX15 |
| Gene Symbols | COX15 |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 |
| Molecular Weight of Antigen | 44 kDa |
| Gene Alias | COX15 (yeast) homolog, cytochrome c oxidase assembly protein, COX15 homolog, cytochrome c oxidase assembly protein (yeast), cytochrome c oxidase assembly protein COX15 homolog, cytochrome c oxidase subunit 15, EC 1.4.4.2, EC 3.1.3.5 |
| Gene ID (Entrez) | 1355 |
| Formulation | PBS, 2% Sucrose with 0.09% Sodium Azide |
| Classification | Polyclonal |
| Immunogen | Synthetic peptides corresponding to COX15(COX15 homolog, cytochrome c oxidase assembly protein (yeast)) The peptide sequence was selected from the N terminal of COX15. Peptide sequence DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY. |
| Reconstitution | Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. |
| Primary or Secondary | Primary |
| Test Specificity | Expected identity based on immunogen sequence: Yeast: 82%. |
YTHD1 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Invitrogen™ Phospho-Tau (Ser202, Thr205) Monoclonal Antibody (AT8)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P10636, P10637 |
| Isotype | IgG1 κ |
| Concentration | 0.2 mg/mL |
| Antigen | Phospho-Tau (Ser202, Thr205) |
| Gene Symbols | MAPT |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | AI413597; AW045860; DDPAC; FLJ31424; FTDP17; FTDP-17; G protein beta1/gamma2 subunit-interacting factor 1; map tau; Mapt; MAPTL; MGC138549; microtubule associated protein tau; microtubule-associated protein tau; microtubule-associated protein tau, isoform 4; microtubules; MSTD; Mtapt; MTBT1; MTBT2; Neurofibrillary tangle protein; neurofibrillary tangles; Neuronal Marker; paired helical filament-tau; PHFtau; PHF-tau; PPND; PPP1R103; protein phosphatase 1, regulatory subunit 103; pTau; RNPTAU; Tau; Tau microtubule-associated protein; tau protein; Tau-4; Tau5; Unknown (protein for MGC:134287) |
| Gene | MAPT |
| Product Type | Antibody |
| Gene ID (Entrez) | 17762, 4137 |
| Formulation | PBS with no preservative |
| Immunogen | Partially purified human PHF-Tau. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | AT8 |
Invitrogen™ GFP Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C |
|---|---|
| Target Species | Tag |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Isotype | IgG |
| Concentration | 2 mg/mL |
| Antigen | GFP |
| Regulatory Status | RUO |
| Purification Method | IgG fraction |
| Gene Alias | GFP; GFP tag; GFP2; green fluorescence; green fluorescent; green fluorescent protein; Turbo eGFP |
| Product Type | Antibody |
| Formulation | PBS with 5mM sodium azide; pH 7.2 |
| Immunogen | The GFP was isolated directly from the jellyfish Aequorea victoria. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ Phospholamban Monoclonal Antibody (2D12)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Canine,Chicken,Guinea Pig,Human,Mouse,Sheep,Pig,Rabbit,Rat |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P26677, P26678, P61012, P61013, P61014, P61015, P61016 |
| Isotype | IgG2a |
| Concentration | 1 mg/mL |
| Antigen | Phospholamban |
| Gene Symbols | PLN |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | cardiac CMH18; Cardiac phospholamban; CMD1P; CMH18; phospholamban; Plb; Plm; PLN; unnamed protein product |
| Gene | PLN |
| Product Type | Antibody |
| Gene ID (Entrez) | 100009299, 100721387, 101102067, 18821, 396378, 397421, 414755, 5350, 64672 |
| Formulation | PBS with 1mg/mL BSA and 0.05% sodium azide |
| Immunogen | Synthetic peptide corresponding to residues D(2) K V Q Y L T R S A I R R A S T I E M P Q Q A R(25) of canine Phospholamban. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 2D12 |
Invitrogen™ HA Tag Monoclonal Antibody (2-2.2.14)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Tag |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Isotype | IgG1 |
| Concentration | 1 mg/mL |
| Antigen | HA Tag |
| Regulatory Status | RUO |
| Purification Method | Protein G |
| Gene Alias | HA; HA Epitope Tag; HA Tag; HA-tag; hemagglutinin |
| Product Type | Antibody |
| Formulation | PBS with 0.05% sodium azide; pH 7.4 |
| Immunogen | HA peptide YPYDVPDYA derivitized to ovalbumin. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 2-2.2.14 |