All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (7)
- (2)
- (3,051)
- (901)
- (1,755)
- (4,347)
- (1)
- (1)
- (3)
- (1)
- (1,205)
- (1,717)
- (796,299)
- (21,219)
- (2)
- (551)
- (60)
- (1)
- (29)
- (5,029)
- (3,330)
- (1,831)
- (213)
- (1)
- (8,787)
- (11,939)
- (2,262)
- (4)
- (3)
- (13)
- (67)
- (5)
- (33)
- (1)
- (2,892)
- (3,719)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (13)
- (2,591)
- (466)
- (1)
- (1)
- (136)
- (236)
- (3)
- (1)
- (3)
- (13)
- (97)
- (1)
- (162,052)
- (201,710)
- (1)
- (24)
- (798)
- (2)
- (10,753)
- (8)
- (3)
- (134)
- (1)
- (4)
- (11)
- (4)
- (9)
- (1)
- (2)
- (5)
- (34)
- (3)
- (1)
- (4)
- (1)
- (108)
- (1)
- (20)
- (11)
- (19)
- (5)
- (1)
- (1)
- (10,813)
- (587)
- (1)
- (2)
- (1)
- (1)
- (9)
- (1)
- (2)
- (2)
- (321)
- (360)
- (5)
- (13,417)
- (2)
- (4,709)
- (2,250)
- (1)
- (14)
- (1)
- (1)
- (7)
- (5,627)
- (3,967)
- (1)
- (18)
- (1)
- (1)
- (2)
- (17,459)
- (16,340)
- (27)
- (1)
- (1)
- (2)
- (5,200)
- (7)
- (3)
- (33)
- (4)
- (13)
- (73)
- (579)
- (17)
- (2)
- (2)
- (1)
- (12)
- (1)
- (1)
- (1)
- (2,083)
- (1)
- (14)
- (3)
- (1)
- (1)
- (2)
- (7)
- (2)
- (2)
- (104)
- (1)
- (3,897)
- (2)
- (20)
- (3)
- (108)
- (1)
- (1)
- (5)
- (1)
- (1)
- (5)
- (195)
- (2)
- (4,818)
- (11)
- (2)
- (5)
- (9)
- (4)
- (17)
- (27)
- (105)
- (7,534)
- (32,536)
- (1,381)
- (53)
- (1,543)
- (3)
- (25)
- (7)
- (1)
- (2,013)
- (1)
- (4,335)
- (41)
- (3)
- (2)
- (3)
- (1)
- (1)
- (4)
- (37)
- (1)
- (1)
- (686)
- (1)
- (1)
- (2)
- (4)
- (6)
- (3)
- (6)
- (1)
- (1)
- (565)
- (2,463)
- (38)
- (1)
- (15)
- (1,622)
- (726)
- (2)
- (2)
- (6)
- (4)
- (5)
- (93,015)
- (62)
- (116)
- (1,893)
- (14,293)
- (3)
- (2)
- (90)
- (2)
- (4)
- (186)
- (8)
- (23)
- (507,076)
- (8)
- (1)
- (673,849)
- (71,178)
- (3)
- (37,425)
- (170)
- (1)
- (1)
- (28,667)
- (9)
- (1)
- (25)
- (2,806)
- (74)
- (89)
- (275)
- (2)
- (51)
- (28,808)
- (28,374)
- (5)
- (29,569)
- (12)
- (28,604)
- (45)
- (92)
- (47)
- (28,871)
- (1)
- (29,446)
- (1)
- (3)
- (1)
- (70)
- (28,856)
- (28,813)
- (129)
- (110)
- (31)
- (146)
- (19)
- (125)
- (5)
- (103)
- (106)
- (2)
- (1)
- (92)
- (6)
- (15)
- (5)
- (32,522)
- (11)
- (3)
- (216)
- (764)
- (1,031)
- (696)
- (751)
- (893)
- (863)
- (989)
- (830)
- (1,417)
- (875)
- (815)
- (1,033)
- (1,037)
- (1,033)
- (666)
- (1,045)
- (30,302)
- (114)
- (16)
- (52)
- (20)
- (1)
- (147)
- (1)
- (176)
- (3)
- (122)
- (27,372)
- (27,429)
- (27,807)
- (63)
- (27,432)
- (23,414)
- (1)
- (60)
- (27,353)
- (27,028)
- (26,972)
- (17)
- (9)
- (1)
- (1)
- (7)
- (5)
- (31,432)
- (5)
- (30)
- (1)
- (1)
- (338)
- (725)
- (28,331)
- (1)
- (30,763)
- (25,480)
- (17,685)
- (17,678)
- (25,454)
- (30,777)
- (38)
- (1)
- (46)
- (9)
- (12)
- (2)
- (103)
- (11)
- (22)
- (58)
- (26)
- (132)
- (171)
- (25)
- (90)
- (57)
- (14)
- (56)
- (73)
- (9)
- (78)
- (83)
- (99)
- (88)
- (90)
- (16)
- (64)
- (64)
- (40)
- (56)
- (50)
- (53)
- (108)
- (134)
- (41)
- (68)
- (65)
- (88)
- (70)
- (454)
- (29,981)
- (7)
- (4)
- (305)
- (387)
- (2,713)
- (3,628)
- (2)
- (3)
- (36)
- (208)
- (2,603)
- (94)
- (31)
- (26,250)
- (514)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (812)
- (138)
- (691)
- (784)
- (367)
- (298)
- (767)
- (695)
- (688)
- (48)
- (690)
- (645)
- (12)
- (29)
- (116)
- (5)
- (274)
- (250)
- (125)
- (126)
- (95)
- (46)
- (12)
- (5)
- (5)
- (9)
- (3)
- (8)
- (2)
- (64)
- (14)
- (470,003)
- (7)
- (266)
- (49)
- (2)
- (366)
- (70)
- (46)
- (25)
- (270)
- (3)
- (3)
- (4)
- (29,288)
- (29,315)
- (29,268)
- (2)
- (20)
- (23)
- (114)
- (798)
- (473)
- (92)
- (5)
- (1,018)
- (2)
- (1)
- (4)
- (113)
- (9)
- (1)
- (6,309)
- (1,290)
- (1)
- (27)
- (2)
- (5,540)
- (175)
- (460)
- (158)
- (6)
- (3)
- (15)
- (27)
- (1)
- (1)
- (270)
- (25)
- (21)
- (63,402)
- (2)
- (1)
- (108)
- (279)
- (175)
- (2,640)
- (3)
- (2)
- (998)
- (38)
- (375,889)
- (14,557)
- (14,046)
- (9,912)
- (60)
- (25)
- (210)
- (9)
- (2)
- (2)
- (1)
- (2)
- (282,238)
- (358)
- (10,315)
- (8)
- (9)
- (6)
- (1)
- (1)
- (4)
- (43)
- (13,176)
- (35)
- (2)
- (1)
- (2)
- (193)
- (207)
- (8,407)
- (76)
- (4)
- (2)
- (2)
- (104)
- (3)
- (2)
- (2)
- (10)
- (19)
- (64)
- (36)
- (3,254)
- (2,113)
- (227,136)
- (74,335)
- (160)
- (54)
- (183,988)
- (400,330)
- (77)
- (918)
- (29,835)
- (40)
- (12,806)
- (376,719)
- (32)
- (101)
- (444)
- (107,651)
- (703)
- (26)
- (11)
- (51)
- (328)
- (22)
- (312)
- (447)
- (261)
- (1,104)
- (2)
- (26)
- (5,420)
- (1)
- (679)
- (5)
- (6)
- (129)
- (1)
- (302)
- (9)
- (728)
- (2)
- (1,063)
- (42)
- (171)
- (6)
- (6)
- (34,557)
- (1)
- (127)
- (16)
- (1,669)
- (22)
- (2)
- (8,649)
- (2)
- (1)
- (434)
- (3)
- (111)
- (1)
- (1,391)
- (18)
- (6)
- (19)
- (1,626)
- (1)
- (1,462)
- (807)
- (663)
- (41)
- (2,660)
- (468)
- (94)
- (7)
- (14)
- (20)
- (7)
- (2,112)
- (242)
- (1)
- (1)
- (1)
- (29)
- (5)
- (2)
- (1)
- (1)
- (919,471)
- (4)
- (2,413)
- (19)
- (1)
- (22)
- (82)
- (105)
- (697,679)
- (5)
- (11)
- (672,703)
- (29,741)
- (56)
- (543)
- (3)
Filtered Search Results
Invitrogen™ beta Actin Loading Control Monoclonal Antibody (BA3R)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat,Rabbit,Chicken |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P29751, P60706, P60709, P60710, P60711 |
| Isotype | IgG2b |
| Concentration | 1 mg/mL |
| Antigen | beta Actin Loading Control |
| Gene Symbols | ACTB |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 0610041G09Rik; AA959943; AAT6; ACT; Act4; Act-4; ACT-5; ACTA; acta1; acta1b; ACTA2; Acta-2; ACTA3; actb; actb.L; actb1; actba; ACTC; actc1; Actc-1; actc1b; ACTE; Actg; ACTG1; Actg2; ACTGE; actin; actin alpha 1; actin alpha 1, skeletal muscle; actin alpha 1, skeletal muscle b; actin alpha 2, smooth muscle; actin alpha cardiac; actin alpha cardiac 1; actin alpha cardiac muscle 1; actin alpha cardiac muscle 1b; actin beta; actin gamma 1; actin gamma 2, smooth muscle; actin, alpha 1, skeletal muscle; actin, alpha 1b, skeletal muscle; actin, alpha 2, smooth muscle, aorta; Actin, alpha cardiac muscle 1; Actin, alpha cardiac muscle 1, intermediate form; actin, alpha cardiac muscle 1b; actin, alpha skeletal muscle; Actin, alpha skeletal muscle, intermediate form; actin, alpha, cardiac 1; actin, alpha, cardiac muscle; actin, alpha, cardiac muscle 1; actin, alpha, vascular smooth muscle; actin, aortic smooth muscle; Actin, aortic smooth muscle, intermediate form; actin, beta; actin, beta 1; actin, beta L homeolog; actin, beta, cytoplasmic; actin, cytoplasmic 1; Actin, cytoplasmic 1, N-terminally processed; Actin, cytoplasmic 2; Actin, cytoplasmic 2, N-terminally processed; actin, gamma 1; actin, gamma 2, smooth muscle, enteric; actin, gamma, cytoplasmic 1; actin, gamma-enteric smooth muscle; Actin, gamma-enteric smooth muscle, intermediate form; actin-like protein; Actl; ACTL3; Acts; ACTSA; ACTSG; Actsk-1; Actvs; Actx; AL023024; alpha actin 1; alpha-actin cardiac; alpha-actin-1; Alpha-actin-2; alpha-actin-3; alphac-actin; Alpha-cardiac actin; alphaSMA; alpha-smooth muscle actin; ASD5; ASMA; a-SMA; Bact; Bact; actin; B-actin; bactin1; bactin1 protein; bactzf; B-ACTZF; beta actin; beta cytoskeletal actin; beta-actin; beta-actin FE-3; beta-actin-1; BRWS1; BRWS2; cardiac muscle alpha actin 1; cardiofunk; cell growth-inhibiting gene 46 protein; Cfk; CFTD; CFTD1; CFTDM; CMD1R; CMH11; cytoplasmic 1; cytoplasmic beta-actin; cytoskeletal beta actin; cytoskeletal gamma-actin; cytoskeletal protein; deafness, autosomal dominant 20; deafness, autosomal dominant 26; DFNA20; DFNA26; E430023M04Rik; E51; epididymis luminal protein 176; fa27h01; fb83f06; gamma non-muscle actin; gamma-2-actin; Gamma-actin; gamma-enteric smooth muscle actin; GIG46; HEL-176; hm:zeh0631; I79_002310; I79_013242; I79_019066; LVNC4; MPFD; MYMY5; NEM1; NEM2; NEM3; nemaline myopathy type 3; PS1TP5-binding protein 1; PS1TP5BP1; SHPM; similar to beta actin; skeletal alpha actin; skeletal alpha1 actin; sma; SMalphaA; SMGA; smooth muscle alpha-actin; smooth muscle gamma-actin; vascular smooth muscle alpha-actin; VSCM; wu:fa27h01; wu:fb63d03; wu:fb83f06; wu:fd18f05; XELAEV_18045052mg; zeh0631 |
| Gene | ACTB |
| Product Type | Antibody |
| Gene ID (Entrez) | 100009272, 11461, 396526, 60, 81822 |
| Formulation | PBS with no preservative; pH 7.2 |
| Immunogen | Beta-actin N-terminal peptide. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | BA3R |
Invitrogen™ 6x-His Tag Monoclonal Antibody (HIS.H8), HRP
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | 4°C |
|---|---|
| Target Species | Tag |
| Host Species | Mouse |
| Conjugate | HRP |
| Applications | Western Blot |
| Form | Liquid |
| Isotype | IgG2b |
| Concentration | 1 mg/mL |
| Antigen | 6x-His Tag |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 6His tag; 6X His; His Tag; Histidine Tag |
| Product Type | Antibody |
| Formulation | PBS with proprietary stabilizer and 0.07% Kathon; pH 7.2 |
| Immunogen | 6x His synthetic peptide. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | HIS.H8 |
Invitrogen™ CFTR Monoclonal Antibody (CF3)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P13569, P26361 |
| Isotype | IgM |
| Concentration | Conc. Not Determined |
| Antigen | CFTR |
| Gene Symbols | CFTR |
| Regulatory Status | RUO |
| Gene Alias | ABC35; Abcc7; ATP Binding Cassette Superfamily C Member 7 (ABCC7); ATP-binding cassette sub-family C member 7; ATP-binding cassette transporter sub-family C member 7; ATP-binding cassette, subfamily c, member 7; AW495489; cAMP-dependent chloride channel; CF; CFTR; CFTR/MRP; Channel conductance-controlling ATPase; cystic fibrosis transmembrane conductance regulator; cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7); cystic fibrosis transmembrane conductance regulator homolog; cystic fibrosis transmembrane conductance regulator homolog; ATP-binding cassette, subfamily c, member 7; dJ760C5.1; MRP7; RGD1561193; tcag7.78; TNR CFTR; TNR-CFTR |
| Gene | CFTR |
| Product Type | Antibody |
| Gene ID (Entrez) | 1080, 12638 |
| Formulation | Ascites with 0.05% sodium azide |
| Immunogen | Synthetic Peptide: G(103) R I I A S Y D P D N K E E R(117). |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | CF3 |
COX15 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
| Host Species | Rabbit |
|---|---|
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Form | Purified |
| Isotype | IgG |
| Gene Accession No. | Q7KZN9-2 |
| Antigen | COX15 |
| Gene Symbols | COX15 |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Molecular Weight of Antigen | 44 kDa |
| Gene Alias | COX15 (yeast) homolog, cytochrome c oxidase assembly protein, COX15 homolog, cytochrome c oxidase assembly protein (yeast), cytochrome c oxidase assembly protein COX15 homolog, cytochrome c oxidase subunit 15, EC 1.4.4.2, EC 3.1.3.5 |
| Gene ID (Entrez) | 1355 |
| Immunogen | Synthetic peptides corresponding to COX15(COX15 homolog, cytochrome c oxidase assembly protein (yeast)) The peptide sequence was selected from the N terminal of COX15. Peptide sequence DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ 6x-His Tag Monoclonal Antibody (HIS.H8), Alexa Fluor™ 488
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | 4°C, do not freeze |
|---|---|
| Target Species | Tag |
| Host Species | Mouse |
| Conjugate | Alexa Fluor 488 |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Isotype | IgG2b |
| Concentration | 1 mg/mL |
| Antigen | 6x-His Tag |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 6His tag; 6X His; His Tag; Histidine Tag |
| Product Type | Antibody |
| Formulation | PBS with 1mg/mL BSA and 0.05% sodium azide |
| Immunogen | 6x His synthetic peptide. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | HIS.H8 |
Human/Mouse Brachyury Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Goat Polyclonal Antibody has been used in 94 publications
Invitrogen™ C1q Monoclonal Antibody (JL-1), Biotin
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | 4°C |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Mouse |
| Conjugate | Biotin |
| Applications | ELISA,Functional Assay,Immunohistochemistry (Frozen),Western Blot |
| Form | Liquid |
| Gene Accession No. | P02745, P02746, P02747, P14106, P31720, P31721, P31722, P98086, Q02105 |
| Isotype | IgG2b |
| Concentration | 0.1 mg/mL |
| Antigen | C1q |
| Gene Symbols | C1QA, C1QB, C1qc |
| Regulatory Status | RUO |
| Purification Method | Protein G |
| Gene Alias | AI255395; AI385742; C1q; C1qa; C1qb; C1qc; C1Q-C; C1QG; Ciqc; complement C1q A chain; complement C1q B chain; complement C1q C chain; complement C1q chain A; complement C1q chain B; complement C1q subcomponent subunit A; complement C1q subcomponent subunit A-like protein; Complement C1q subcomponent subunit B; Complement C1q subcomponent subunit C; complement component 1, q subcomponent, A chain; complement component 1, q subcomponent, alpha polypeptide; complement component 1, q subcomponent, B chain; complement component 1, q subcomponent, beta polypeptide; complement component 1, q subcomponent, C chain; complement component 1, q subcomponent, c polypeptide; complement component 1, q subcomponent, gamma polypeptide; complement component C1q, A chain; complement component C1q, B chain; complement subcomponent C1q chain B |
| Gene | C1QA |
| Product Type | Antibody |
| Gene ID (Entrez) | 12259, 12260, 12262, 29687, 298566, 362634, 712, 713, 714 |
| Formulation | PBS with 0.1% BSA and 0.02% sodium azide |
| Immunogen | Purified mouse C1q. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | JL-1 |
Invitrogen™ Phospho-Tau (Thr181) Monoclonal Antibody (AT270)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunohistochemistry (Paraffin),Western Blot |
| Form | Liquid |
| Gene Accession No. | P10636 |
| Isotype | IgG1 κ |
| Concentration | 0.2 mg/mL |
| Antigen | Phospho-Tau (Thr181) |
| Gene Symbols | MAPT |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | AI413597; AW045860; DDPAC; FLJ31424; FTDP17; FTDP-17; G protein beta1/gamma2 subunit-interacting factor 1; map tau; Mapt; MAPTL; MGC138549; microtubule associated protein tau; microtubule-associated protein tau; microtubule-associated protein tau, isoform 4; microtubules; MSTD; Mtapt; MTBT1; MTBT2; Neurofibrillary tangle protein; neurofibrillary tangles; Neuronal Marker; paired helical filament-tau; PHFtau; PHF-tau; PPND; PPP1R103; protein phosphatase 1, regulatory subunit 103; pTau; RNPTAU; Tau; Tau microtubule-associated protein; tau protein; Tau-4; Tau5; Unknown (protein for MGC:134287) |
| Gene | MAPT |
| Product Type | Antibody |
| Gene ID (Entrez) | 4137 |
| Formulation | PBS with no preservative |
| Immunogen | Partially purified human PHF-Tau. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | AT270 |
| Content And Storage | Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance. |
|---|---|
| Target Species | Bacteria |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunofluorescence,Western Blot |
| Form | Serum |
| Isotype | IgG |
| Research Discipline | Signaling |
| Antigen | FtsZ (GTPase) |
| Gene Symbols | FtsZ;BSU15290 |
| Regulatory Status | RUO |
| Purification Method | Unpurified |
| Dilution | Western Blotting Analysis: A representative lot detected FtsZ (GTPase) in Western Blotting applications (Lucet, I., et. al. (2000). EMBO J. 19(7):1467-75; Bisson-Filho, A.W., et. al. (2017). Science. 355(6326):739-743).Immunofluorescence Analysis: A representative lot detected FtsZ (GTPase) in Immunofluorescence applications (Daniel, R.A., et. al. (2000). Mol Microbiol. 35(2):299-311). |
| Gene Alias | Cell division protein FtsZ;Cell Division FtsZ GTPase |
| Gene ID (Entrez) | NP_389412 |
| Formulation | Rabbit polyclonal antiserum with 0.05% sodium azide. |
| Immunogen | Full length purified FtsZ from Bacillus subtilis. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | This rabbit polyclonal antibody detects Cell Division Protein FTsZ in Bacillus subtilis. |
YTHD1 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Invitrogen™ Pma1p Monoclonal Antibody (40B7)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Yeast |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P05030 |
| Isotype | IgG |
| Concentration | Conc. Not Determined |
| Antigen | Pma1p |
| Gene Symbols | PMA1 |
| Regulatory Status | RUO |
| Gene Alias | PMA1 |
| Gene | PMA1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 852876 |
| Formulation | Cell culture media with 5mM sodium azide |
| Immunogen | Yeast nuclear prep. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 40B7 |
HSP60 Antibody (LK2), DyLight 594, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
Ly-6G/Ly-6C Monoclonal Antibody (RB6-8C5), Functional Grade, eBioscience™, Invitrogen™
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Herpes Simplex Virus Type-1, Goat, FITC, Polyclonal Antibody, Abnova™
Goat polyclonal antibody raised against Herpes Simplex Virus Type-1.