All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (7)
- (2)
- (3,051)
- (901)
- (1,755)
- (4,347)
- (1)
- (1)
- (3)
- (1)
- (1,205)
- (1,717)
- (796,300)
- (21,219)
- (2)
- (551)
- (60)
- (1)
- (29)
- (5,029)
- (3,330)
- (1,831)
- (213)
- (1)
- (8,787)
- (11,939)
- (2,262)
- (4)
- (3)
- (13)
- (67)
- (5)
- (34)
- (1)
- (2,892)
- (3,719)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (13)
- (2,591)
- (466)
- (1)
- (1)
- (136)
- (236)
- (3)
- (1)
- (3)
- (13)
- (97)
- (1)
- (159,346)
- (201,694)
- (1)
- (24)
- (798)
- (2)
- (10,748)
- (8)
- (3)
- (134)
- (1)
- (4)
- (11)
- (4)
- (9)
- (1)
- (2)
- (5)
- (34)
- (3)
- (1)
- (4)
- (1)
- (108)
- (1)
- (20)
- (11)
- (19)
- (5)
- (1)
- (1)
- (10,813)
- (587)
- (1)
- (2)
- (1)
- (1)
- (9)
- (1)
- (2)
- (2)
- (321)
- (360)
- (5)
- (12,291)
- (2)
- (4,709)
- (2,250)
- (1)
- (14)
- (1)
- (1)
- (7)
- (5,627)
- (3,967)
- (1)
- (18)
- (1)
- (1)
- (2)
- (17,459)
- (16,329)
- (27)
- (1)
- (1)
- (2)
- (5,196)
- (7)
- (3)
- (33)
- (4)
- (13)
- (73)
- (579)
- (17)
- (2)
- (2)
- (1)
- (12)
- (1)
- (1)
- (1)
- (2,083)
- (1)
- (14)
- (3)
- (1)
- (1)
- (2)
- (7)
- (2)
- (2)
- (104)
- (1)
- (3,897)
- (2)
- (20)
- (3)
- (108)
- (1)
- (1)
- (5)
- (1)
- (1)
- (5)
- (195)
- (2)
- (4,818)
- (11)
- (2)
- (5)
- (9)
- (4)
- (17)
- (27)
- (105)
- (7,511)
- (32,537)
- (1,381)
- (53)
- (1,543)
- (3)
- (25)
- (7)
- (1)
- (2,013)
- (1)
- (4,335)
- (41)
- (3)
- (2)
- (3)
- (1)
- (1)
- (4)
- (37)
- (1)
- (1)
- (686)
- (1)
- (1)
- (2)
- (4)
- (6)
- (3)
- (6)
- (1)
- (1)
- (565)
- (2,463)
- (38)
- (1)
- (15)
- (1,622)
- (726)
- (2)
- (2)
- (6)
- (4)
- (5)
- (93,015)
- (62)
- (116)
- (1,893)
- (14,328)
- (3)
- (2)
- (50)
- (4)
- (186)
- (8)
- (23)
- (506,450)
- (8)
- (1)
- (670,619)
- (71,152)
- (3)
- (37,425)
- (170)
- (1)
- (1)
- (28,665)
- (9)
- (1)
- (25)
- (2,806)
- (74)
- (89)
- (275)
- (2)
- (51)
- (28,808)
- (28,374)
- (5)
- (29,569)
- (12)
- (28,604)
- (45)
- (92)
- (47)
- (28,871)
- (1)
- (29,446)
- (1)
- (3)
- (1)
- (70)
- (28,856)
- (28,813)
- (111)
- (106)
- (31)
- (127)
- (19)
- (125)
- (5)
- (103)
- (106)
- (2)
- (1)
- (92)
- (6)
- (15)
- (5)
- (32,522)
- (11)
- (3)
- (216)
- (764)
- (1,027)
- (692)
- (749)
- (891)
- (855)
- (989)
- (830)
- (1,413)
- (875)
- (815)
- (1,033)
- (1,035)
- (1,033)
- (666)
- (1,043)
- (30,302)
- (114)
- (16)
- (52)
- (20)
- (1)
- (147)
- (1)
- (176)
- (3)
- (122)
- (27,372)
- (27,429)
- (27,807)
- (63)
- (27,432)
- (23,414)
- (1)
- (60)
- (27,353)
- (27,028)
- (26,972)
- (17)
- (9)
- (1)
- (1)
- (7)
- (5)
- (31,432)
- (5)
- (30)
- (1)
- (1)
- (338)
- (725)
- (28,330)
- (1)
- (30,763)
- (25,480)
- (17,685)
- (17,678)
- (25,454)
- (30,777)
- (38)
- (1)
- (46)
- (9)
- (12)
- (2)
- (103)
- (11)
- (22)
- (58)
- (26)
- (132)
- (171)
- (25)
- (90)
- (57)
- (14)
- (55)
- (73)
- (9)
- (78)
- (83)
- (99)
- (88)
- (90)
- (16)
- (64)
- (64)
- (40)
- (56)
- (50)
- (53)
- (108)
- (134)
- (41)
- (68)
- (65)
- (88)
- (70)
- (454)
- (29,981)
- (7)
- (4)
- (305)
- (387)
- (2,713)
- (3,628)
- (2)
- (3)
- (36)
- (208)
- (2,603)
- (94)
- (31)
- (26,250)
- (514)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (812)
- (138)
- (691)
- (784)
- (367)
- (298)
- (767)
- (695)
- (688)
- (48)
- (690)
- (645)
- (12)
- (29)
- (116)
- (5)
- (274)
- (250)
- (125)
- (126)
- (95)
- (46)
- (12)
- (5)
- (5)
- (9)
- (3)
- (8)
- (2)
- (64)
- (14)
- (466,187)
- (7)
- (266)
- (49)
- (2)
- (366)
- (70)
- (46)
- (25)
- (270)
- (3)
- (3)
- (4)
- (29,288)
- (29,315)
- (29,268)
- (2)
- (20)
- (23)
- (114)
- (798)
- (473)
- (92)
- (5)
- (1,018)
- (2)
- (1)
- (4)
- (113)
- (9)
- (1)
- (6,309)
- (1,290)
- (1)
- (25)
- (5,497)
- (175)
- (452)
- (158)
- (6)
- (3)
- (15)
- (27)
- (1)
- (1)
- (270)
- (25)
- (21)
- (63,402)
- (2)
- (1)
- (108)
- (279)
- (175)
- (2,603)
- (3)
- (2)
- (998)
- (38)
- (374,700)
- (14,557)
- (14,046)
- (9,912)
- (60)
- (25)
- (210)
- (9)
- (2)
- (2)
- (1)
- (2)
- (281,296)
- (358)
- (10,315)
- (8)
- (9)
- (6)
- (1)
- (1)
- (4)
- (43)
- (13,175)
- (35)
- (2)
- (1)
- (2)
- (193)
- (207)
- (8,407)
- (76)
- (4)
- (2)
- (2)
- (104)
- (3)
- (2)
- (2)
- (10)
- (19)
- (64)
- (36)
- (3,254)
- (2,113)
- (225,703)
- (74,335)
- (160)
- (54)
- (183,988)
- (400,333)
- (77)
- (918)
- (29,789)
- (40)
- (12,805)
- (375,517)
- (32)
- (101)
- (444)
- (107,347)
- (703)
- (26)
- (11)
- (51)
- (328)
- (22)
- (312)
- (447)
- (261)
- (1,104)
- (2)
- (26)
- (5,420)
- (1)
- (677)
- (5)
- (6)
- (129)
- (1)
- (302)
- (9)
- (728)
- (2)
- (1,063)
- (42)
- (165)
- (6)
- (6)
- (34,557)
- (1)
- (127)
- (16)
- (1,669)
- (22)
- (2)
- (8,649)
- (2)
- (1)
- (434)
- (3)
- (111)
- (1)
- (1,391)
- (18)
- (6)
- (19)
- (1,626)
- (1)
- (1,462)
- (807)
- (663)
- (41)
- (2,660)
- (468)
- (94)
- (7)
- (14)
- (20)
- (7)
- (2,112)
- (242)
- (1)
- (1)
- (1)
- (29)
- (5)
- (2)
- (1)
- (1)
- (915,860)
- (4)
- (2,413)
- (19)
- (1)
- (22)
- (82)
- (105)
- (697,288)
- (5)
- (11)
- (672,695)
- (26,251)
- (56)
- (543)
- (3)
Filtered Search Results
Invitrogen™ beta Actin Loading Control Monoclonal Antibody (BA3R)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat,Rabbit,Chicken |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P29751, P60706, P60709, P60710, P60711 |
| Isotype | IgG2b |
| Concentration | 1 mg/mL |
| Antigen | beta Actin Loading Control |
| Gene Symbols | ACTB |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 0610041G09Rik; AA959943; AAT6; ACT; Act4; Act-4; ACT-5; ACTA; acta1; acta1b; ACTA2; Acta-2; ACTA3; actb; actb.L; actb1; actba; ACTC; actc1; Actc-1; actc1b; ACTE; Actg; ACTG1; Actg2; ACTGE; actin; actin alpha 1; actin alpha 1, skeletal muscle; actin alpha 1, skeletal muscle b; actin alpha 2, smooth muscle; actin alpha cardiac; actin alpha cardiac 1; actin alpha cardiac muscle 1; actin alpha cardiac muscle 1b; actin beta; actin gamma 1; actin gamma 2, smooth muscle; actin, alpha 1, skeletal muscle; actin, alpha 1b, skeletal muscle; actin, alpha 2, smooth muscle, aorta; Actin, alpha cardiac muscle 1; Actin, alpha cardiac muscle 1, intermediate form; actin, alpha cardiac muscle 1b; actin, alpha skeletal muscle; Actin, alpha skeletal muscle, intermediate form; actin, alpha, cardiac 1; actin, alpha, cardiac muscle; actin, alpha, cardiac muscle 1; actin, alpha, vascular smooth muscle; actin, aortic smooth muscle; Actin, aortic smooth muscle, intermediate form; actin, beta; actin, beta 1; actin, beta L homeolog; actin, beta, cytoplasmic; actin, cytoplasmic 1; Actin, cytoplasmic 1, N-terminally processed; Actin, cytoplasmic 2; Actin, cytoplasmic 2, N-terminally processed; actin, gamma 1; actin, gamma 2, smooth muscle, enteric; actin, gamma, cytoplasmic 1; actin, gamma-enteric smooth muscle; Actin, gamma-enteric smooth muscle, intermediate form; actin-like protein; Actl; ACTL3; Acts; ACTSA; ACTSG; Actsk-1; Actvs; Actx; AL023024; alpha actin 1; alpha-actin cardiac; alpha-actin-1; Alpha-actin-2; alpha-actin-3; alphac-actin; Alpha-cardiac actin; alphaSMA; alpha-smooth muscle actin; ASD5; ASMA; a-SMA; Bact; Bact; actin; B-actin; bactin1; bactin1 protein; bactzf; B-ACTZF; beta actin; beta cytoskeletal actin; beta-actin; beta-actin FE-3; beta-actin-1; BRWS1; BRWS2; cardiac muscle alpha actin 1; cardiofunk; cell growth-inhibiting gene 46 protein; Cfk; CFTD; CFTD1; CFTDM; CMD1R; CMH11; cytoplasmic 1; cytoplasmic beta-actin; cytoskeletal beta actin; cytoskeletal gamma-actin; cytoskeletal protein; deafness, autosomal dominant 20; deafness, autosomal dominant 26; DFNA20; DFNA26; E430023M04Rik; E51; epididymis luminal protein 176; fa27h01; fb83f06; gamma non-muscle actin; gamma-2-actin; Gamma-actin; gamma-enteric smooth muscle actin; GIG46; HEL-176; hm:zeh0631; I79_002310; I79_013242; I79_019066; LVNC4; MPFD; MYMY5; NEM1; NEM2; NEM3; nemaline myopathy type 3; PS1TP5-binding protein 1; PS1TP5BP1; SHPM; similar to beta actin; skeletal alpha actin; skeletal alpha1 actin; sma; SMalphaA; SMGA; smooth muscle alpha-actin; smooth muscle gamma-actin; vascular smooth muscle alpha-actin; VSCM; wu:fa27h01; wu:fb63d03; wu:fb83f06; wu:fd18f05; XELAEV_18045052mg; zeh0631 |
| Gene | ACTB |
| Product Type | Antibody |
| Gene ID (Entrez) | 100009272, 11461, 396526, 60, 81822 |
| Formulation | PBS with no preservative; pH 7.2 |
| Immunogen | Beta-actin N-terminal peptide. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | BA3R |
Invitrogen™ 6x-His Tag Monoclonal Antibody (HIS.H8), HRP
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | 4°C |
|---|---|
| Target Species | Tag |
| Host Species | Mouse |
| Conjugate | HRP |
| Applications | Western Blot |
| Form | Liquid |
| Isotype | IgG2b |
| Concentration | 1 mg/mL |
| Antigen | 6x-His Tag |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 6His tag; 6X His; His Tag; Histidine Tag |
| Product Type | Antibody |
| Formulation | PBS with proprietary stabilizer and 0.07% Kathon; pH 7.2 |
| Immunogen | 6x His synthetic peptide. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | HIS.H8 |
Invitrogen™ CFTR Monoclonal Antibody (CF3)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P13569, P26361 |
| Isotype | IgM |
| Concentration | Conc. Not Determined |
| Antigen | CFTR |
| Gene Symbols | CFTR |
| Regulatory Status | RUO |
| Gene Alias | ABC35; Abcc7; ATP Binding Cassette Superfamily C Member 7 (ABCC7); ATP-binding cassette sub-family C member 7; ATP-binding cassette transporter sub-family C member 7; ATP-binding cassette, subfamily c, member 7; AW495489; cAMP-dependent chloride channel; CF; CFTR; CFTR/MRP; Channel conductance-controlling ATPase; cystic fibrosis transmembrane conductance regulator; cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7); cystic fibrosis transmembrane conductance regulator homolog; cystic fibrosis transmembrane conductance regulator homolog; ATP-binding cassette, subfamily c, member 7; dJ760C5.1; MRP7; RGD1561193; tcag7.78; TNR CFTR; TNR-CFTR |
| Gene | CFTR |
| Product Type | Antibody |
| Gene ID (Entrez) | 1080, 12638 |
| Formulation | Ascites with 0.05% sodium azide |
| Immunogen | Synthetic Peptide: G(103) R I I A S Y D P D N K E E R(117). |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | CF3 |
COX15 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
| Host Species | Rabbit |
|---|---|
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Form | Purified |
| Isotype | IgG |
| Gene Accession No. | Q7KZN9-2 |
| Antigen | COX15 |
| Gene Symbols | COX15 |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Molecular Weight of Antigen | 44 kDa |
| Gene Alias | COX15 (yeast) homolog, cytochrome c oxidase assembly protein, COX15 homolog, cytochrome c oxidase assembly protein (yeast), cytochrome c oxidase assembly protein COX15 homolog, cytochrome c oxidase subunit 15, EC 1.4.4.2, EC 3.1.3.5 |
| Gene ID (Entrez) | 1355 |
| Immunogen | Synthetic peptides corresponding to COX15(COX15 homolog, cytochrome c oxidase assembly protein (yeast)) The peptide sequence was selected from the N terminal of COX15. Peptide sequence DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Human/Mouse Brachyury Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Goat Polyclonal Antibody has been used in 94 publications
Invitrogen™ 6x-His Tag Monoclonal Antibody (HIS.H8), Alexa Fluor™ 488
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | 4°C, do not freeze |
|---|---|
| Target Species | Tag |
| Host Species | Mouse |
| Conjugate | Alexa Fluor 488 |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Isotype | IgG2b |
| Concentration | 1 mg/mL |
| Antigen | 6x-His Tag |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 6His tag; 6X His; His Tag; Histidine Tag |
| Product Type | Antibody |
| Formulation | PBS with 1mg/mL BSA and 0.05% sodium azide |
| Immunogen | 6x His synthetic peptide. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | HIS.H8 |
Invitrogen™ Phospho-Tau (Thr181) Monoclonal Antibody (AT270)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunohistochemistry (Paraffin),Western Blot |
| Form | Liquid |
| Gene Accession No. | P10636 |
| Isotype | IgG1 κ |
| Concentration | 0.2 mg/mL |
| Antigen | Phospho-Tau (Thr181) |
| Gene Symbols | MAPT |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | AI413597; AW045860; DDPAC; FLJ31424; FTDP17; FTDP-17; G protein beta1/gamma2 subunit-interacting factor 1; map tau; Mapt; MAPTL; MGC138549; microtubule associated protein tau; microtubule-associated protein tau; microtubule-associated protein tau, isoform 4; microtubules; MSTD; Mtapt; MTBT1; MTBT2; Neurofibrillary tangle protein; neurofibrillary tangles; Neuronal Marker; paired helical filament-tau; PHFtau; PHF-tau; PPND; PPP1R103; protein phosphatase 1, regulatory subunit 103; pTau; RNPTAU; Tau; Tau microtubule-associated protein; tau protein; Tau-4; Tau5; Unknown (protein for MGC:134287) |
| Gene | MAPT |
| Product Type | Antibody |
| Gene ID (Entrez) | 4137 |
| Formulation | PBS with no preservative |
| Immunogen | Partially purified human PHF-Tau. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | AT270 |
Invitrogen™ 6x-His Tag Monoclonal Antibody (4E3D10H2/E3)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Tag |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Isotype | IgG1 |
| Concentration | 1 mg/mL |
| Antigen | 6x-His Tag |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 6His tag; 6X His; His Tag; Histidine Tag |
| Product Type | Antibody |
| Formulation | PBS with 1mg/mL BSA, 30% glycerol and 0.05% sodium azide |
| Immunogen | Mixture of N-terminal and C-terminal 6x-His peptides, CG-HHHHHH and HHHHHH-GC. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 4E3D10H2/E3 |
Ly-6G/Ly-6C Monoclonal Antibody (RB6-8C5), Functional Grade, eBioscience™, Invitrogen™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Herpes Simplex Virus Type-1, Goat, FITC, Polyclonal Antibody, Abnova™
Goat polyclonal antibody raised against Herpes Simplex Virus Type-1.
Invitrogen™ TOM20 Recombinant Rabbit Monoclonal Antibody (10G6I8)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | Q15388, Q62760, Q9DCC8 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | TOM20 |
| Gene Symbols | TOMM20 |
| Regulatory Status | RUO |
| Purification Method | Affinity Chromatography |
| Gene Alias | 1810060K07Rik; BB284719; Gm19268; KIAA0016; MAS20; mitochondrial 20 kDa outer membrane protein; Mitochondrial import receptor subunit TOM20 homolog; mKIAA0016; MOM19; outer mitochondrial membrane receptor rTOM20; outer mitochondrial membrane receptor Tom20; TOM20; TOMM20; translocase of outer mitochondrial membrane 20; translocase of outer mitochondrial membrane 20 homolog (yeast); translocase of outer mitochondrial membrane 20 homolog type II |
| Gene | TOMM20 |
| Product Type | Antibody |
| Gene ID (Entrez) | 266601, 67952, 9804 |
| Formulation | PBS with 0.05% BSA, 50% glycerol and 0.05% ProClin 300; pH 7.3 |
| Immunogen | Recombinant protein (or fragment). |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | 10G6I8 |
Human/Primate IL-15 Biotinylated Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody has been used in 4 publications
| Antigen | IL-15 |
|---|---|
| Regulatory Status | RUO |
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
| Target Species | Human,Primate |
| Host Species | Mouse |
| Conjugate | Biotin |
| Applications | Western Blot,ELISA |
| Form | Purified |
| Gene ID (Entrez) | 3600 |
| Classification | Monoclonal |
| Immunogen | E. coli-derived recombinant human IL-15 Asn49-Ser162 Accession # P40933 |
| Primary or Secondary | Primary |
| Clone | 34593 |
Invitrogen™ EN1 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P09065, Q05925 |
| Isotype | IgG |
| Concentration | 0.45 mg/mL |
| Antigen | EN1 |
| Gene Symbols | EN1 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography, Protein A |
| Gene Alias | En1; En-1; engrailed 1; engrailed homeobox 1; engrailed homolog 1; engrailed-1; HME1; homeobox protein en-1; Homeobox protein engrailed-1; hu-En-1; Mo-en.1; mo-En-1 |
| Gene | EN1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 13798, 2019 |
| Formulation | PBS with 0.09% sodium azide; pH 7.4 |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human EN1 (Engrailed 1). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |