Organic Acids
Medchemexpress LLC GRGDSP TFA | 98.0% | 701.61 | 25 MG
GRGDSP (TFA) is an integrin inhibitor. This synthetic linear RGD peptide can inhibit the adherence of tumor cells to endothelial cells of blood vessels, thereby limiting metastasis. It is also utilized to modify the surface of cardiovascular implants, such as vascular grafts, to promote endothelialization, and is widely employed in integrin research as a soluble integrin-blocking RGD-based peptide.
- Inhibits adherence of tumor cells to endothelial cells of blood vessels
- Limits metastasis
- Promotes endothelialization for cardiovascular implants
- Used in integrin research
- Functions as a soluble integrin-blocking RGD-based peptide
Medchemexpress LLC TAT peptide TFA | 99.8% | 1735.93 | 25 MG
TAT peptide (TFA) is a cell penetrating peptide (GRKKRRQRRRPQ) derived from the trans-activating transcriptional activator (Tat) from HIV-1. It has been studied in functionalized hybrid nanoparticles for magnetic enrichment and optical detection in cell separation and rapid cell labelling, demonstrating good biocompatibility.
- Derived from trans-activating transcriptional activator (Tat) from HIV-1
- Cell penetrating peptide (GRKKRRQRRRPQ)
- Used in functionalized hybrid nanoparticles for cell separation
- Used in rapid cell labelling
- Shows good biocompatibility
- For research use only
Cambridge Isotope Laboratories BUTYRIC ACID (D7, 98%), 5 G, 73607-83-7
BUTYRIC ACID (D7, 98%), 5 G, 73607-83-7
Medchemexpress LLC Tpp-CAQK TFA | 99.1% | 906.95 | 5 MG
Tpp-CAQK TAF can bind to mitochondria, enabling the construction of an engineered mitochondrial compound, Mito-Tpp-CAQK TFA, with excellent bioactivity. Mito-Tpp-CAQK TFA can be internalized by macrophages, thereby enhancing the phagocytosis of myelin debris, alleviating mitochondrial dysfunction, and reducing proinflammatory profiles, ultimately facilitating tissue repair and functional recovery in mice after spinal cord injury.
- Binds to mitochondria
- Enables construction of Mito-Tpp-CAQK TFA
- Enhances phagocytosis of myelin debris
- Alleviates mitochondrial dysfunction
- Reduces proinflammatory profiles
- Facilitates tissue repair and functional recovery in spinal cord injury
Medchemexpress LLC NN1177 (TFA) | 98.7% | 4570.07 (free base) | 25 MG
NN1177 TFA is a long-acting GLP-1/glucagon receptor co-agonist. It induces dose-dependent body weight loss in diet-induced obese mice. This product is for research use only.
- Long-acting GLP-1/glucagon receptor co-agonist
- Induces dose-dependent body weight loss in diet-induced obese mice
- Reduces CYP3A4 mRNA expression and activity in human hepatocytes
- Improves glucose tolerance in diet-induced obese mice
- Reduces liver fat and inflammatory biomarkers in NASH model mice
Medchemexpress LLC TL033 TFA | 2746343-70-2 | 98.1% | 1630.83 | 5 MG
TL033 TFA (HY-147340A) is a chemical compound with CAS number 2746343-70-2 and a molecular weight of 1630.83. This product is supplied as a light yellow to yellow solid with a high purity of 98.1% (HPLC). It requires specific storage conditions to maintain its integrity, ensuring reliability for research applications.
- CAS number: 2746343-70-2
- Purity (HPLC): 98.1%
- Molecular weight: 1630.83
- Appearance: Light yellow to yellow solid
- Recommended storage (solid): -20°C, sealed, away from moisture and light
- Storage in solvent: -80°C (6 months) or -20°C (1 month), sealed, away from moisture and light
Medchemexpress LLC D-phenylalanyl-prolyl-arginyl chloromethyl ketone trifluoroacetate | 157379-44-7 | 99.8% | 1 ML
PPACK TFA is a potent, selective, irreversible thrombin inhibitor supplied as a 10 mM solution in DMSO (1 mL). It is used as an anticoagulant and a biochemical tool to inhibit thrombin activity in blood-sample handling and enzymatic assays.
- Potent, selective, irreversible thrombin inhibitor.
- Supplied as a 10 mM solution in DMSO, 1 mL.
- High purity for reproducible experimental results.
- Molecular weight 564.99 g/mol; CAS 157379-44-7.
- Store sealed and away from moisture; follow storage instructions for solution and powder.
Medchemexpress LLC Ql9 tfa | 95.91% | 5 MG
QL9 (QLSPFPFDL) TFA is a high-affinity alloantigen for the 2C T cell receptor (TCR), intended for research use only.
- High-affinity alloantigen
- Specific for the 2C T cell receptor (TCR)
- Suitable for research applications
![Medchemexpress LLC L-Prolinamide, N,N-bis(phenylmethyl)glycyl]-4-[4-[[4-[[(phenylmethyl)amino]phosphonomethyl] | 99.9% | 1323.35 | 1 MG](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000386801-logo.png-250.jpg){kind=logo}
Medchemexpress LLC L-Prolinamide, N,N-bis(phenylmethyl)glycyl]-4-[4-[[4-[[(phenylmethyl)amino]phosphonomethyl] | 99.9% | 1323.35 | 1 MG
OncoACP3 TFA from MedChemExpress is a small-molecule ligand of prostatic acid phosphatase (ACP3). This product is applicable to research related to prostate cancer.
- Molecular formula: C62H82F3N12O15P
- Molecular weight: 1323.35
- Appearance: White to off-white solid
- Storage: Powder at -20°C for 3 years; in solvent at -80°C for 6 months, or -20°C for 1 month
- Purity (LCMS): 99.87%
Medchemexpress LLC Z-VRPR-FMK TFA | 1926163-57-6 | MFCD18782585 | 95.9% | 790.81 | 100 UG
Z-VRPR-FMK (TFA) (VRPR), a tetrapeptide, is a selective and irreversible MALT1 (Mucosa-associated lymphoid tissue lymphoma translocation protein 1) inhibitor. It can protect against influenza A virus (IAV) infection.
- Selective and irreversible MALT1 inhibitor
- Tetrapeptide
- Protects against influenza A virus (IAV) infection
Medchemexpress LLC G7-18NATE TFA | 98.1% | 1417.5 | 5 MG
G7-18NATE TFA is a peptide inhibitor of Grb7. It binds to the Grb7-SH2 domain with micromolar affinity (Kd = 18.1 μM). G7-18NATE TFA inhibits cell proliferation, motility, cell invasion, and 3D culture formation in several cancer cell lines. For research use only, not sold to patients.
- Peptide inhibitor of Grb7.
- Binds to the Grb7-SH2 domain with micromolar affinity (Kd = 18.1 μM).
- Inhibits cell proliferation, motility, cell invasion, and 3D culture formation in several cancer cell lines.
- Purity: 98.1%.
Medchemexpress LLC aStAx-35R TFA | 99.1% | 2392.86 | 1 MG
aStAx-35R TFA is a stapled peptide that functions as an antagonist of the nuclear form of β-catenin, thereby inhibiting Wnt signaling. It competitively prevents the binding of β-catenin to TCF4 and selectively induces growth inhibition in Wnt-dependent cancer cells.
- Directly targets and antagonizes the nuclear form of β-catenin.
- Effectively inhibits the Wnt signaling pathway.
- Competitively inhibits the binding of β-catenin to TCF4.
- Selectively induces growth inhibition in cancer cells dependent on Wnt signaling.
Medchemexpress LLC (RXR)4XB TFA | 96.6% | 1904.37 | 1 MG
(RXR)4XB TFA is a cell-penetrating peptide that binds phosphorodiamidate morpholino oligomers (PMOs), forming peptide-conjugated PMOs (PPMOs), and enhances the delivery of PMO into bacterial cells. The (RXR)4XB TFA-PMO conjugate is effective in preventing biofilm formation, inhibiting *Pseudomonas aeruginosa* with an MIC50 of 0.5 to 16 μM, and reducing bacterial burden in mouse acute pneumonia models.
- Forms peptide-conjugated PMOs (PPMOs)
- Enhances delivery of PMO into bacterial cells
- Prevents biofilm formation
- Inhibits *Pseudomonas aeruginosa*
- Reduces bacterial burden in mouse acute pneumonia models
Medchemexpress LLC Pardaxin P5 TFA | 67995-63-5 | ≥98% | 3381.87 | 1 MG
Pardaxin P5 TFA is the trifluoroacetate salt form of Pardaxin P5. This antimicrobial peptide is known to inhibit Escherichia coli with a MIC value of 13 μM, making it suitable for anti-infection research.
- Antimicrobial peptide
- Inhibits Escherichia coli with a MIC value of 13 μM
- TFA salt form of Pardaxin P5
- Supplied as a solid
- Specific peptide sequence: GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE
- Soluble in DMSO (100 mg/mL, requires ultrasonic)
- Targets bacterial organisms and anti-infection pathways