Fluorobenzenes
- (1)
- (280)
- (1)
- (1)
- (28)
- (7)
- (6)
- (75)
- (22)
- (15)
- (1)
- (2)
- (1)
- (2)
- (1)
- (262)
- (1)
- (16)
- (3)
- (20)
- (56)
- (2)
- (400)
- (1)
- (7)
- (2)
- (18)
- (10)
- (5)
- (29)
- (9)
- (2)
- (3)
- (14)
- (9)
- (5)
- (20)
- (5)
- (19)
- (1)
- (4)
- (7)
- (5)
- (18)
- (6)
- (2)
- (4)
- (4)
- (8)
- (7)
- (32)
- (16)
- (2)
- (9)
- (5)
- (1)
- (8)
- (7)
- (1)
- (4)
- (4)
- (6)
- (8)
- (1)
- (1)
- (2)
- (2)
- (4)
- (2)
- (10)
- (17)
- (2)
- (24)
- (1)
- (2)
- (13)
- (2)
- (3)
- (4)
- (1)
- (3)
- (8)
- (3)
- (2)
- (7)
- (2)
- (11)
- (1)
- (2)
- (10)
- (1)
- (4)
- (1)
- (5)
- (2)
- (18)
- (6)
- (6)
- (20)
- (1)
- (4)
- (8)
- (2)
- (2)
- (1)
- (1)
- (8)
- (3)
- (1)
- (4)
- (1)
- (11)
- (18)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (1)
- (2)
- (5)
- (5)
- (6)
- (2)
- (1)
- (2)
- (3)
- (5)
- (2)
- (4)
- (2)
- (1)
- (5)
- (4)
- (1)
- (2)
- (2)
- (1)
- (14)
- (2)
- (3)
- (2)
- (3)
- (14)
- (15)
- (1)
- (4)
- (21)
- (9)
- (3)
- (1)
- (8)
- (5)
- (2)
- (1)
- (1)
- (2)
- (2)
- (4)
- (1)
- (3)
- (3)
- (1)
- (2)
- (4)
- (2)
- (1)
- (4)
- (5)
- (6)
- (3)
- (2)
- (1)
- (2)
- (1)
- (2)
- (4)
- (24)
- (1)
- (1)
- (2)
- (2)
- (4)
- (2)
- (19)
- (14)
- (4)
- (5)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (8)
- (4)
- (1)
- (1)
- (2)
- (5)
- (1)
- (6)
- (1)
- (1)
- (1)
- (1)
- (2)
- (6)
- (1)
- (1)
- (5)
- (2)
- (1)
- (15)
- (14)
- (2)
- (8)
- (8)
- (2)
- (1)
- (3)
- (1)
- (1)
- (1)
- (1)
- (1)
- (3)
- (1)
- (4)
- (1)
- (2)
- (1)
- (2)
- (2)
- (2)
- (3)
- (3)
- (2)
- (4)
- (2)
- (2)
- (1)
- (1)
- (3)
- (2)
- (3)
- (1)
- (5)
- (1)
- (3)
- (1)
- (1)
- (7)
- (4)
- (1)
- (3)
- (5)
- (9)
- (2)
- (2)
- (2)
- (4)
- (2)
- (1)
- (2)
- (2)
- (1)
- (1)
- (2)
- (2)
- (10)
- (2)
- (3)
- (1)
- (7)
- (2)
- (5)
- (11)
- (3)
- (4)
- (2)
- (6)
- (4)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (16)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (4)
- (1)
- (2)
- (2)
- (2)
- (4)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (2)
- (3)
- (5)
- (7)
- (2)
- (1)
- (8)
- (2)
- (1)
- (1)
- (2)
- (1)
- (6)
- (1)
- (2)
- (1)
- (2)
- (2)
- (4)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (4)
- (2)
- (2)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (2)
- (5)
- (2)
- (5)
- (2)
- (2)
- (2)
- (4)
- (2)
- (8)
- (2)
- (1)
- (4)
- (16)
- (1)
- (2)
- (7)
- (2)
- (6)
- (46)
- (2)
- (5)
- (1)
- (1)
- (2)
- (4)
- (62)
- (250)
- (2)
- (40)
- (2)
- (4)
- (2)
- (5)
- (2)
- (15)
- (1)
- (2)
- (14)
- (1)
- (33)
- (2)
- (1)
- (1)
- (2)
- (28)
- (75)
- (151)
- (6)
- (216)
- (2)
- (144)
- (8)
- (1)
- (4)
- (22)
- (1)
- (242)
- (8)
- (2)
- (3)
- (6)
- (333)
- (2)
- (1)
- (3)
- (3)
- (3)
- (15)
- (3)
- (64)
- (2)
- (2)
- (1)
- (3)
- (2)
- (2)
- (1)
- (5)
- (1)
- (1)
- (2)
- (2)
- (2)
- (6)
- (2)
- (2)
- (2)
- (2)
- (3)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (3)
- (7)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (3)
- (2)
- (3)
- (3)
- (1)
- (5)
- (3)
- (5)
- (1)
- (1)
- (1)
- (3)
- (8)
- (2)
- (2)
- (2)
- (1)
- (2)
- (6)
- (5)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (3)
- (2)
- (2)
- (1)
- (4)
- (2)
- (2)
- (6)
- (4)
- (3)
- (1)
- (3)
- (2)
- (3)
- (3)
- (2)
- (3)
- (8)
- (3)
- (3)
- (3)
- (2)
- (3)
- (5)
- (3)
- (3)
- (3)
- (4)
- (1)
- (2)
- (3)
- (3)
- (6)
- (2)
- (3)
- (3)
- (2)
- (6)
- (3)
- (3)
- (2)
- (3)
- (2)
- (1)
- (3)
- (2)
- (2)
- (2)
- (6)
- (3)
- (5)
- (5)
- (6)
- (3)
- (3)
- (4)
- (3)
- (9)
- (2)
- (2)
- (2)
- (2)
- (2)
- (4)
- (3)
- (2)
- (2)
- (2)
- (2)
- (1)
- (1)
- (2)
- (2)
- (2)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (2)
- (3)
- (3)
- (2)
- (1)
- (5)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (3)
- (3)
- (2)
- (2)
- (1)
- (2)
- (3)
- (1)
- (2)
- (2)
- (3)
- (4)
- (5)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (1)
- (1)
- (2)
- (3)
- (1)
- (3)
- (1)
- (2)
- (2)
- (4)
- (2)
- (3)
- (2)
- (3)
- (5)
- (4)
- (3)
- (2)
- (3)
- (1)
- (3)
- (7)
- (3)
- (5)
- (7)
- (4)
- (2)
- (3)
- (1)
- (3)
- (2)
- (1)
- (2)
- (2)
- (3)
- (10)
- (1)
- (3)
- (1)
- (1)
- (2)
- (10)
- (2)
- (1)
- (2)
- (3)
- (4)
- (2)
- (1)
- (3)
- (6)
- (1)
- (2)
- (3)
- (2)
Filtered Search Results
Medchemexpress LLC Stieeqaktfldkfnheaedlfyqsslaswn | 95.3% | 3649.88 | 10 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN is an angiotensin-converting enzyme 2 (ACE2) related peptide. It is used to study the function of ACE2 and has a molecular weight of 3649.88 with a chemical formula of C164H238N40O55. It appears as a white to off-white solid and is intended for research use only, not for human use.
- Angiotensin-converting enzyme 2 (ACE2) related peptide
- Used to study the function of ACE2
- Molecular weight of 3649.88
- White to off-white solid appearance
- For research use only
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 1891087-61-8 | Medchem Express | BAY-1816032 | 5mg | 446257905 | HY-103020 | 534.524 | C27H24F2N6O4
Ambeed | 4-Isobutoxybenzoic acid | 1g | 767148739 | A546838 | 30762-00-6 | MFCD01993659 | 194.230 | C11H14O3
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Selleck Chemical LLC Darapladib
Darapladib is a reversible lipoprotein-associated phospholipase A2 (Lp-PLA2) inhibitor with IC50 of 0 25 nM Phase 3
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Apexbio Technology LLC Dexlansoprazole,50mg CAS# 138530-94-6
Dexlansoprazole, the dextrorotatory enantiomer of lansoprazole, is a proton pump inhibitor (PPI) formulated to have dual delayed-release properties. Other sizes are also available. Please inqury us for quote.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC (Rac)-AZD 6482 | 663620-70-0 | 98.5% | C22H24N4O4 | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
(Rac)-AZD 6482 is the racemate of AZD 6482. It is a potent and selective p110β inhibitor, with an IC50 of 0.69 nM. This compound is intended for research use only.
- Potent and selective p110β inhibitor
- IC50 of 0.69 nM
- Racemate of AZD 6482
- Solid appearance
- White to light yellow color
- For research use only
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 405169-16-6 | Medchem Express | Dovitinib | 10mg | 446271226 | HY-50905 | MFCD10565680 | 392.438 | C21H21FN6O
Pharmablock | 4-bromo-3-methyl-1H-benzimidazol-2-one | 25mg | 761042302 | PBT4215 | 913297-44-6 | MFCD27932420 | 227.061 | C8H7BrN2O
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Selleck Chemical LLC MM-102
MM-102 (HMTase Inhibitor IX) is a high-affinity peptidomimetic inhibitor of the WDR5/MLL1 protein-protein interaction which bind to WDR5 with Ki 1 nM and IC50 2 4nM This product may precipitate when dissolved in saline solution or PBS solution It is recommended to prepare the stock solution in DMSO solution
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 1613638-82-6 | Medchem Express | CDK8-IN-4 | 5mg | 746319233 | HY-111465 | 330.391 | C20H18N4O
Ambeed | 3-Bromo-2-fluoro-6-methylphenylboronic acid | 250mg | 717677882 | A593134 | 2246650-88-2 | MFCD28515375 | 232.840 | C7H7BBrFO2
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 186544-26-3 | Medchem Express | LY 344864 | 5mg | 446263513 | HY-13788 | MFCD07772184 | 351.425 | C21H22FN3O
Ambeed | 7-Methoxybenzo[d]thiazole | 250mg | 601097796 | A757977 | 2942-12-3 | MFCD22201203 | 165.210 | C8H7NOS
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 1431953-77-3 | 2-(4-(3-CHLORO-4-FLUOROPHENYL)-5-OXO-4,5-DIHYDRO-1H-1,2,4-TRIAZOL-3-YL)ACETIC ACID | 1g
Pharmablock | tert-butyl 3-aminoazetidine-1-carboxylate | 50mg | 551184439 | PB00002 | 193269-78-2 | MFCD01861753 | 172.228 | C8H16N2O2
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Apexbio Technology LLC NF 340 10MG
NF 340 10MG APEXBIO TECHNOLOGIES
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Selleck Chemical LLC GK921
GK921 is a transglutaminase 2 (TGase 2) inhibitor with an IC50 of 8 93 M under a modified assay condition
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 945966-46-1 | Medchem Express | Apararenone | 5mg | 446259448 | HY-109002 | 364.39 | C17H17FN2O4S
Medchem Express | Apararenone | 5mg | 446259448 | HY-109002 | 945966-46-1 | 364.390 | C17H17FN2O4S
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 1005168-10-4 | Medchem Express | Asivatrep | 1mg | 446261777 | HY-12777 | MFCD28502100 | 491.48 | C21H22F5N3O3S
Pharmablock | benzyl (3R)-3-hydroxypiperidine-1-carboxylate | 250mg | 551058972 | PB00793 | 100858-34-2 | MFCD11112280 | 235.283 | C13H17NO3
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Oritinib | 2035089-28-0 | 99.6% | 539.67 g/mol | C31H37N7O2 | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Oritinib is an irreversible, third-generation EGFR tyrosine kinase inhibitor developed to overcome T790M-mediated resistance. Supplied as a high-purity solid research compound, it is used in preclinical biochemical and cellular studies to interrogate EGFR signaling and resistance mechanisms.
- Irreversible third-generation EGFR inhibitor.
- Active against T790M resistance mutations.
- High chemical purity (99.6%).
- Provided as a solid suitable for dosing and formulation.
- Applicable to biochemical and cellular assays.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More