Cresols
Bromocresol Purple, Water Soluble, Spectrum™ Chemical
CAS: 62625-30-3
Medchemexpress LLC R-1 Methanandamide Phosphate | 649569-33-5 | 98.0% | 10 MG
R-1 Methanandamide Phosphate is a water-soluble prodrug analog of arachidonylethanolamide (AEA), an endogenous cannabinoid compound.
- Water-soluble prodrug analog
- Endogenous cannabinoid compound (AEA)
- Soluble in DMSO
- Suitable for in vivo dissolution protocols
Medchemexpress LLC R-1 Methanandamide Phosphate | 649569-33-5 | 98.0% | 1 ML
R-1 Methanandamide Phosphate is a water-soluble prodrug analog of arachidonylethanolamide (AEA), an endogenous cannabinoid compound. It is intended for research use only and not for patient use.
- Water-soluble prodrug analog of arachidonylethanolamide (AEA)
- Endogenous cannabinoid compound
- Appears as a viscous liquid
- Yellow to brown color
- For research use only
- Store at -20°C, protected from light
- When in solvent, store at -80°C for 6 months or -20°C for 1 month, protected from light
Medchemexpress LLC R-1 methanandamide phosphate | 649569-33-5 | MFCD08062135 | >=98.0% | 441.54 g·mol⁻¹ | C23H40NO5P | 5 MG
R-1 Methanandamide Phosphate is a water-soluble phosphate prodrug analog of arachidonylethanolamide (AEA), an endogenous cannabinoid. Provided for research use, it enables aqueous handling and delivery compared with the parent lipid AEA and is supplied both as a solid and as ready-to-use DMSO solution for biochemical and cellular studies.
- Water-soluble phosphate prodrug of arachidonylethanolamide (AEA).
- Facilitates aqueous handling and administration compared with lipid AEA.
- Suitable for in vitro research on cannabinoid receptor signaling.
- Available as powder and as 10 mM solution in DMSO.
- High purity reported (≥98%).
- Molecular weight 441.54 g·mol⁻¹; formula C23H40NO5P.
Cayman Chemical p-Cresol sulfatepotasIM500mg
A sulfate conjugate of p-cresol; increases migration and proliferation of isolated rat aortic VSMCs at 500 µM; increases aortic atherosclerotic plaques lesion area in nephrectomized ApoE-/- mice fed a high-fat diet when administered at 100 mg/kg per day via the drinking water; serum levels are increased in patients with advanced stage chronic kidney disease and positively associated with vascular calcification
Cayman Chemical p-Cresol sulfatepotasIM100mg
A sulfate conjugate of p-cresol; increases migration and proliferation of isolated rat aortic VSMCs at 500 µM; increases aortic atherosclerotic plaques lesion area in nephrectomized ApoE-/- mice fed a high-fat diet when administered at 100 mg/kg per day via the drinking water; serum levels are increased in patients with advanced stage chronic kidney disease and positively associated with vascular calcification
Cayman Chemical p-Cresol sulfatepotasIum s 1g
A sulfate conjugate of p-cresol; increases migration and proliferation of isolated rat aortic VSMCs at 500 µM; increases aortic atherosclerotic plaques lesion area in nephrectomized ApoE-/- mice fed a high-fat diet when administered at 100 mg/kg per day via the drinking water; serum levels are increased in patients with advanced stage chronic kidney disease and positively associated with vascular calcification
Cayman Chemical p-Cresol sulfatepotasIM250mg
A sulfate conjugate of p-cresol; increases migration and proliferation of isolated rat aortic VSMCs at 500 µM; increases aortic atherosclerotic plaques lesion area in nephrectomized ApoE-/- mice fed a high-fat diet when administered at 100 mg/kg per day via the drinking water; serum levels are increased in patients with advanced stage chronic kidney disease and positively associated with vascular calcification
Medchemexpress LLC Potassium p-nitrophenyl sulfate | 6217-68-1 | 99.89% | 257.26 | 500 MG
Potassium p-nitrophenyl sulfate is a chromogenic substrate used for arylsulfatase. It is released by arylsulfonase cleavage, allowing the activity of arylsulfonase to be quantitatively determined by colorimetric detection at 400 nm.
- Chromogenic substrate for arylsulfatase
- Supports quantitative determination of arylsulfonase activity
- Solid appearance
- Off-white to yellow color
- Soluble in H2O at 25 mg/mL
FUJIFILM BIOSCIENCES INC p-Amidinophenylmethanesulf
p-APMSF is used as a serine protease activity inhibitor Since it specifically suppresses the activity of blood coagulation factor Xa it is used for the study of blood coagulation mechanism Compared to DFP diisopropylfluorophosphate it is easy to handle because it is powder and soluble to water In addition it is reported that serine protease inhibitory activity is several hundred times higher than DFP and PMSF It inhibits the activity of trypsin thrombin plasmin kallikrein and others It does not affect chymotrypsin or acetylcholinesterase For research use only RUO
TARGETMOL CHEMICALS INC FOSAPREPITANT DIMEGLUMIN 25MG
Also available in 5 mg 10 mg 50 mg 100 mg 1 mL 10 mM (in DMSO) and bulk. Please contact Fisher for quotes. Fosaprepitant dimeglumine (MK-0517) is the dimeglumine salt form of fosaprepitant the water-soluble N-phosphorylated prodrug of aprepitant with antiemetic activity. Upon intravenous administration and rapid conversion to aprepitant this agent binds selectively to the human substance P/neurokinin 1 (NK1) receptors in the central nervous system (CNS). This inhibits receptor binding of the endogenous substance P and prevents substance P-induced emesis. purity: 98%
Medchemexpress LLC C-Type Natriuretic Peptide (1-53), human TFA | 141294-77-1 | 99.94% | 5801.77 | 10 MG
C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. This natriuretic peptide family peptide is involved in the maintenance of electrolyte-fluid balance and vascular tone.
- Molecular formula: C251H417N81O71S3.xC2HF3O2
- Appearance: Solid
- Color: White to off-white
- Sequence (shortened): DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys37-Cys55)
- Solubility: H2O: 50 mg/mL (ultrasonic needed)
- Target: Angiotensin receptor
- Pathway: GPCR/G protein
Medchemexpress LLC Atrial natriuretic peptide (1-28), human, porcine, biotin-labeled | 1815618-06-4 | 99.4% | 3308.80 | 1 MG
Atrial natriuretic peptide (1-28), human, porcine, biotin-labeled, is one of three mammalian natriuretic peptides (NPs) and has endocrine effects on fluid homeostasis and blood pressure. It has potential for cardiovascular diseases research.
- Purity: 99.43%
- Molecular weight: 3308.80
- Formula: C137H217N47O41S4
- CAS no.: 1815618-06-4
- Appearance: Solid, white to off-white
- Sequence: Biotin-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (disulfide bridge: Cys7-Cys23)
- Sequence shortening: Biotin-SLRRSSCFGGRMDRIGAQSGLGCNSFRY (disulfide bridge: Cys7-Cys23)
- Solubility (in vitro): H2O: 5 mg/mL (1.51 mM; needs ultrasonic)