Antibiotics
- (3)
- (1)
- (1)
- (181)
- (28)
- (31)
- (6)
- (18)
- (1)
- (1)
- (42)
- (1)
- (8)
- (5)
- (31)
- (1)
- (2)
- (1)
- (1)
- (4)
- (1)
- (79)
- (10)
- (3)
- (48)
- (2)
- (1)
- (1)
- (1)
- (2)
- (3)
- (4)
- (5)
- (1)
- (1)
- (2)
- (151)
- (7)
- (13)
- (4)
- (23)
- (4)
- (1)
- (28)
- (191)
- (6)
- (1)
- (23)
- (22)
- (1)
- (10)
- (1)
- (23)
- (1)
- (20)
- (1)
- (31)
- (1)
- (1)
- (24)
- (1)
- (2)
- (1)
- (11)
- (187)
- (10)
- (9)
- (4)
- (7)
- (111)
- (10)
- (1)
- (1)
- (561)
- (2)
- (16)
- (52)
- (3)
- (144)
- (1)
- (2)
- (1)
- (5)
- (1)
- (2)
- (2)
- (13)
- (3)
- (1)
- (4)
- (5)
- (1)
- (4)
- (2)
- (17)
- (1)
- (4)
- (7)
- (1)
- (3)
- (2)
- (4)
- (1)
- (2)
- (5)
- (1)
- (2)
- (5)
- (6)
- (2)
- (3)
- (1)
- (2)
- (1)
- (9)
- (3)
- (2)
- (2)
- (3)
- (3)
- (12)
- (2)
- (2)
- (2)
- (7)
- (3)
- (2)
- (2)
- (1)
- (2)
- (4)
- (6)
- (2)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (5)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (4)
- (2)
- (2)
- (5)
- (4)
- (2)
- (2)
- (1)
- (4)
- (7)
- (3)
- (2)
- (3)
- (1)
- (2)
- (2)
- (2)
- (3)
- (3)
- (2)
- (2)
- (3)
- (2)
- (1)
- (3)
- (2)
- (2)
- (3)
- (2)
- (1)
- (2)
- (4)
- (4)
- (2)
- (1)
- (3)
- (2)
- (1)
- (5)
- (9)
- (2)
- (1)
- (3)
- (4)
- (7)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (3)
- (2)
- (1)
- (2)
- (7)
- (6)
- (3)
- (3)
- (2)
- (16)
- (1)
- (2)
- (2)
- (2)
- (2)
- (11)
- (1)
- (4)
- (3)
- (3)
- (2)
- (1)
- (4)
- (1)
- (11)
- (7)
- (2)
- (3)
- (1)
- (1)
- (2)
- (7)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (4)
- (1)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (3)
- (2)
- (1)
- (2)
- (2)
- (5)
- (1)
- (3)
- (4)
- (5)
- (6)
- (5)
- (4)
- (2)
- (1)
- (2)
- (5)
- (2)
- (4)
- (9)
- (9)
- (7)
- (4)
- (3)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (8)
- (1)
- (8)
- (2)
- (14)
- (3)
- (8)
- (1)
- (14)
- (2)
- (2)
- (3)
- (2)
- (4)
- (7)
- (3)
- (2)
- (3)
- (2)
- (3)
- (2)
- (17)
- (4)
- (1)
- (3)
- (2)
- (6)
- (2)
- (1)
- (1)
- (3)
- (6)
- (3)
- (2)
- (1)
- (1)
- (8)
- (4)
- (3)
- (6)
- (3)
- (5)
- (6)
- (1)
- (7)
- (9)
- (2)
- (1)
- (1)
- (1)
- (3)
- (3)
- (3)
- (1)
- (7)
- (1)
- (1)
- (9)
- (4)
- (1)
- (1)
- (3)
- (13)
- (1)
- (5)
- (2)
- (1)
- (1)
- (1)
- (17)
- (8)
- (1)
- (2)
- (4)
- (1)
- (1)
- (1)
- (2)
- (1)
- (4)
- (2)
- (1)
- (1)
- (3)
- (2)
- (6)
- (5)
- (2)
- (8)
- (2)
- (2)
- (2)
- (2)
- (1)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (2)
- (1)
- (1)
- (2)
- (2)
- (3)
- (1)
- (2)
- (2)
- (2)
- (1)
- (2)
- (7)
- (4)
- (2)
- (1)
- (3)
- (6)
- (4)
- (2)
- (1)
- (2)
- (6)
- (2)
- (2)
- (3)
- (2)
- (3)
- (2)
- (1)
- (5)
- (5)
- (3)
- (8)
- (2)
- (1)
- (2)
- (1)
- (5)
- (2)
- (3)
- (2)
- (2)
- (1)
- (1)
- (1)
- (10)
- (2)
- (2)
- (7)
- (1)
- (2)
- (2)
- (2)
- (4)
- (1)
- (7)
- (1)
- (2)
- (2)
- (5)
- (5)
- (2)
- (2)
- (2)
- (1)
- (5)
- (3)
- (2)
- (1)
- (1)
- (3)
- (3)
- (1)
- (1)
- (5)
- (4)
- (4)
- (3)
- (1)
- (3)
- (2)
- (2)
- (4)
- (3)
- (2)
- (5)
- (1)
- (2)
- (3)
- (2)
- (4)
- (3)
- (2)
- (4)
- (2)
- (2)
- (13)
- (3)
- (2)
- (1)
- (2)
- (2)
- (5)
- (2)
- (3)
- (7)
- (6)
- (2)
- (4)
- (1)
- (2)
- (3)
- (9)
- (2)
- (7)
- (2)
- (2)
- (1)
- (5)
- (9)
- (1)
- (2)
- (4)
- (7)
- (4)
- (7)
- (5)
- (10)
- (2)
- (1)
- (2)
- (3)
- (10)
- (1)
- (2)
- (4)
- (1)
- (2)
- (3)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (3)
- (11)
- (1)
- (3)
- (2)
- (10)
- (5)
- (1)
- (13)
- (1)
- (2)
- (2)
- (1)
- (1)
- (4)
- (1)
- (3)
- (1)
- (2)
- (3)
- (2)
- (8)
- (2)
- (1)
- (2)
- (1)
- (20)
- (1)
- (4)
- (2)
- (2)
- (1)
- (4)
- (1)
- (2)
- (2)
- (2)
- (3)
- (9)
- (2)
- (2)
- (5)
- (1)
- (3)
- (4)
- (1)
- (13)
- (11)
- (1)
- (3)
- (12)
- (7)
- (2)
- (2)
- (14)
- (3)
- (3)
- (3)
- (3)
- (4)
- (1)
- (5)
- (2)
- (1)
- (16)
- (1)
- (2)
- (2)
- (1)
- (1)
- (2)
- (7)
- (1)
- (2)
- (17)
- (7)
- (2)
- (8)
- (2)
- (3)
- (3)
- (2)
- (10)
- (5)
- (8)
- (5)
- (3)
- (1)
- (7)
- (2)
- (4)
- (2)
- (12)
- (2)
- (8)
- (5)
- (3)
- (9)
- (3)
- (6)
- (1)
- (4)
- (3)
- (398)
- (15)
- (2)
- (34)
- (19)
- (54)
- (28)
- (76)
Filtered Search Results
Medchemexpress LLC HY-B0108 100mg , Daptomycin LY146032 CAS:103060-53-3 Purity:98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-B0108 100mg Daptomycin LY146032 CAS:103060-53-3 Formula:C72H101N17O26 Purity:98% Daptomycin is a lipopeptide antibiotic with rapid in vitro bactericidal activity against gram-positive organisms. Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-100229 25mg , Aloxistatin E64d;E64c ethyl ester CAS:88321-09-9 Purity:98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-100229 25mg Aloxistatin E64d;E64c ethyl ester CAS:88321-09-9 Formula:C17H30N2O5 Cysteine protease Purity:98% Aloxistatin (E64d) is a broad-spectrum cell-permeable cysteine protease inhibitor. Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-104028A 10mg Medchemexpress, BAY 73-6691 racemate CAS:794568-90-4 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-104028A 10mg BAY 73-6691 racemate CAS:794568-90-4 BAY 73-6691 racemate is a phosphodiesterase 9 inhibitor extracted from patent WO 2017070293 A1. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Sigma Aldrich Fine Chemicals Biosciences Quinine hemisulfate salt monohydrate synthetic, >=90% (HPLC) | 207671-44-1 | MFCD00150790 | 50G
Quinine hemisulfate salt monohydrate synthetic, >=90% (HPLC) | Purity: >=90% (HPLC) | Mol Wt: 391.47 | 207671-44-1 | MFCD00150790 | 50G
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-112171 500mg Medchemexpress, γ-L-Glutamyl-L-alanine CAS:5875-41-2 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-112171 500mg γ-L-Glutamyl-L-alanine CAS:5875-41-2 γ-L-Glutamyl-L-alanine, composed of gamma-glutamate and alanine, is a proteolytic breakdown product of larger proteins. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-112620 10mg Medchemexpress, MS21570 CAS:65373-29-7 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-112620 10mg MS21570 CAS:65373-29-7 MS21570 is a selective GPR171 antagonist, with an IC50 of 220 nM. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
CPC Scientific H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-OH (trifluoroacetate salt) 1MG
Peptide found to have anabolic effect on bone formation in rats that can inhibit the rapid decline in bone formation due to denervation.ONE-LETTER SEQUENCE: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAMOLECULAR FORMULA: C180H287N57O48MOLECULAR WEIGHT:4016.57STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [112955-31-4], RESEARCH AREA: OsteoporosisREFERENCES: L.J. Suva et al., Science, 237, 893 (1987)
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Sirtuin modulator 2 | 667910-69-2 | 99.2% | 349.41 | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Sirtuin modulator 2 (Compound 132) is a sirtuin modulator that exhibits an ED50 equal to or less than 50 μM. This product is intended for research use only.
- Sirtuin modulator with an ED50 ≤ 50 μM
- Available in various quantities (5 mg, 10 mg, 25 mg, 50 mg)
- High purity of 99.22%
- Chemical structure provided
- Solubility information available for *in vitro* and *in vivo* applications
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-108943 500mg Medchemexpress, Sabinene CAS:3387-41-5 Purity:98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress,HY-108943 500mg Sabinene CAS:3387-41-5 Formula:C10H16 Sabinene is a perfume additive which is being explored as the component for the next generation aircraft fuel. Purity:98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-A0098 2mg Medchemexpress, Tunicamycin CAS:11089-65-9 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-A0098 2mg Tunicamycin CAS:11089-65-9 Tunicamycin is a mixture of homologous nucleoside antibiotic that inhibits N-linked glycosylation and blocks GlcNAc phosphotransferase (GPT). Tunicamycin causes accumulation of unfolded proteins in cell endoplasmic reticulum (ER) and induces ER stress, and causes blocking of DNA synthesis and cell cycle arrest in G1 phase. Tunicamycin inhibits gram-positive bacteria, yeasts, fungi, and viruses and has anti-cancer activity[2][3].Tunicamycin increases exosome release in cervical cancer cells[4]. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 14402-89-2 | Medchem Express | Sodium nitroprusside | 100mg | 415688718 | HY-B0564 | MFCD00003506 | 261.921 | C5FeN6Na2O
Wortmannin | Medchem Express | 19545-26-7 | MFCD00133927 | 428.437 | C23H24O8 | 98.000 | COC[C@H]1OC(=O)c2coc3c2[C@@]1(C)C1=C([C@@H]2CCC(=O)[C@@]2(C)C[C@H]1OC(C)=O)C3=O | 100mg | 724442513
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Sigma Aldrich Fine Chemicals Biosciences Chlortetracycline Selective Supplement suitable for microbiology | 57-62-5 | MFCD00864876 | 5VL
Chlortetracycline Selective Supplement suitable for microbiology | Mol Wt: 478.88 | 57-62-5 | MFCD00864876 | 5VL
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Enzo Life Sciences Alamethicin (25mg). CAS: 27061-78-5
Mixture of alamethicin homologs. Membrane permeabilizing antibiotic. Applications include increasing [32P] incorporation into phosphatidylinositol 4-phosphate and permeabilization of sarcoplasmic reticulum vesicles. Causes fusion of lipid vesicles. Alternative name: U-22324. Purity: ≥98% (TLC). Solubility: Soluble in DMSO, 100% ethanol or methanol. Long Term Storage: +4°C.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Taranabant racemate (MK-0364 racemate) | 701977-00-6 | 99.8% | 515.95 | C27H25ClF3N3O2 | 100 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Taranabant racemate (MK-0364 racemate) is a research-grade small-molecule antagonist and/or inverse agonist of the cannabinoid-1 (CB1) receptor. Supplied as a high-purity solid, it is intended for in vitro and preclinical research; consult the manufacturer's datasheet and SDS for handling, storage, and safety information.
- Acts as a cannabinoid-1 (CB1) receptor antagonist and/or inverse agonist.
- High purity (99.84% as documented by the manufacturer).
- Molecular formula C27H25ClF3N3O2.
- Molecular weight 515.95.
- Listed CAS number 701977-00-6.
- Intended for research use only; not for human or veterinary use.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-15651 100mg , Alvelestat AZD9668 CAS:848141-11-7 Purity:98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-15651 100mg Alvelestat AZD9668 CAS:848141-11-7 Formula:C25H22F3N5O4S Purity:98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More