Antibiotics
- (3)
- (1)
- (1)
- (179)
- (26)
- (31)
- (6)
- (18)
- (1)
- (1)
- (41)
- (1)
- (8)
- (5)
- (31)
- (1)
- (2)
- (1)
- (1)
- (4)
- (1)
- (77)
- (10)
- (3)
- (48)
- (2)
- (1)
- (1)
- (1)
- (2)
- (3)
- (4)
- (5)
- (1)
- (2)
- (145)
- (7)
- (13)
- (4)
- (23)
- (4)
- (1)
- (28)
- (188)
- (6)
- (1)
- (23)
- (22)
- (1)
- (9)
- (1)
- (23)
- (1)
- (20)
- (1)
- (30)
- (1)
- (1)
- (24)
- (1)
- (2)
- (1)
- (11)
- (187)
- (10)
- (9)
- (4)
- (7)
- (111)
- (10)
- (1)
- (1)
- (561)
- (2)
- (16)
- (52)
- (3)
- (144)
- (1)
- (2)
- (1)
- (5)
- (1)
- (2)
- (2)
- (13)
- (3)
- (1)
- (4)
- (5)
- (1)
- (4)
- (2)
- (17)
- (1)
- (4)
- (7)
- (1)
- (3)
- (2)
- (4)
- (1)
- (2)
- (5)
- (1)
- (2)
- (5)
- (6)
- (2)
- (3)
- (1)
- (2)
- (1)
- (9)
- (3)
- (2)
- (2)
- (3)
- (3)
- (12)
- (2)
- (2)
- (2)
- (7)
- (3)
- (2)
- (2)
- (1)
- (2)
- (4)
- (6)
- (2)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (5)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (4)
- (2)
- (2)
- (5)
- (4)
- (2)
- (2)
- (1)
- (4)
- (7)
- (3)
- (2)
- (3)
- (1)
- (2)
- (2)
- (2)
- (3)
- (3)
- (2)
- (2)
- (3)
- (2)
- (1)
- (3)
- (2)
- (2)
- (3)
- (2)
- (1)
- (2)
- (4)
- (4)
- (2)
- (1)
- (3)
- (2)
- (1)
- (5)
- (9)
- (2)
- (1)
- (3)
- (4)
- (7)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (3)
- (2)
- (1)
- (2)
- (7)
- (6)
- (3)
- (3)
- (2)
- (16)
- (1)
- (2)
- (2)
- (2)
- (2)
- (11)
- (1)
- (4)
- (3)
- (3)
- (2)
- (1)
- (4)
- (1)
- (11)
- (7)
- (2)
- (3)
- (1)
- (1)
- (2)
- (7)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (4)
- (1)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (3)
- (2)
- (1)
- (2)
- (2)
- (5)
- (1)
- (3)
- (4)
- (5)
- (6)
- (5)
- (4)
- (2)
- (1)
- (2)
- (5)
- (2)
- (4)
- (9)
- (9)
- (7)
- (4)
- (3)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (8)
- (1)
- (8)
- (2)
- (14)
- (3)
- (8)
- (1)
- (14)
- (2)
- (2)
- (3)
- (2)
- (4)
- (7)
- (3)
- (2)
- (3)
- (2)
- (3)
- (2)
- (17)
- (4)
- (1)
- (3)
- (2)
- (6)
- (2)
- (1)
- (1)
- (3)
- (6)
- (3)
- (2)
- (1)
- (1)
- (8)
- (4)
- (3)
- (6)
- (3)
- (5)
- (6)
- (1)
- (7)
- (9)
- (2)
- (1)
- (1)
- (1)
- (3)
- (3)
- (3)
- (1)
- (7)
- (1)
- (1)
- (9)
- (4)
- (1)
- (1)
- (3)
- (13)
- (5)
- (2)
- (1)
- (1)
- (1)
- (17)
- (8)
- (2)
- (4)
- (1)
- (1)
- (1)
- (4)
- (2)
- (1)
- (3)
- (2)
- (6)
- (5)
- (2)
- (8)
- (2)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (3)
- (1)
- (2)
- (2)
- (2)
- (1)
- (2)
- (7)
- (4)
- (2)
- (1)
- (3)
- (6)
- (4)
- (1)
- (2)
- (6)
- (2)
- (2)
- (3)
- (2)
- (3)
- (2)
- (1)
- (5)
- (5)
- (3)
- (8)
- (1)
- (2)
- (1)
- (5)
- (2)
- (3)
- (2)
- (2)
- (1)
- (1)
- (10)
- (2)
- (2)
- (7)
- (1)
- (2)
- (2)
- (2)
- (4)
- (1)
- (7)
- (1)
- (2)
- (2)
- (5)
- (5)
- (2)
- (2)
- (2)
- (1)
- (5)
- (3)
- (2)
- (1)
- (1)
- (3)
- (3)
- (1)
- (1)
- (5)
- (4)
- (4)
- (3)
- (1)
- (3)
- (2)
- (2)
- (4)
- (3)
- (2)
- (5)
- (1)
- (2)
- (3)
- (2)
- (4)
- (3)
- (2)
- (4)
- (2)
- (2)
- (13)
- (3)
- (2)
- (1)
- (2)
- (2)
- (5)
- (2)
- (3)
- (7)
- (6)
- (2)
- (4)
- (1)
- (2)
- (3)
- (9)
- (2)
- (7)
- (2)
- (2)
- (1)
- (5)
- (9)
- (1)
- (2)
- (4)
- (7)
- (4)
- (7)
- (5)
- (10)
- (2)
- (1)
- (2)
- (3)
- (10)
- (1)
- (2)
- (4)
- (1)
- (2)
- (3)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (3)
- (11)
- (1)
- (3)
- (2)
- (10)
- (5)
- (1)
- (13)
- (1)
- (2)
- (2)
- (1)
- (1)
- (4)
- (1)
- (3)
- (1)
- (2)
- (3)
- (2)
- (8)
- (2)
- (1)
- (2)
- (1)
- (20)
- (1)
- (4)
- (2)
- (2)
- (1)
- (4)
- (1)
- (2)
- (2)
- (2)
- (3)
- (9)
- (2)
- (2)
- (5)
- (1)
- (3)
- (4)
- (1)
- (13)
- (11)
- (1)
- (3)
- (12)
- (7)
- (2)
- (2)
- (14)
- (3)
- (3)
- (3)
- (3)
- (4)
- (1)
- (5)
- (2)
- (1)
- (16)
- (1)
- (2)
- (2)
- (1)
- (1)
- (2)
- (7)
- (1)
- (2)
- (17)
- (7)
- (2)
- (8)
- (2)
- (3)
- (3)
- (2)
- (10)
- (5)
- (8)
- (5)
- (3)
- (1)
- (7)
- (2)
- (4)
- (2)
- (12)
- (2)
- (8)
- (5)
- (3)
- (9)
- (3)
- (6)
- (1)
- (4)
- (3)
- (398)
- (15)
- (2)
- (34)
- (19)
- (54)
- (28)
- (76)
Filtered Search Results
eMolecules 37527-48-3 | Ambeed | 6-Chloro-7H-purin-8(9H)-one | 50mg | 649783013 | A516259 | MFCD12755941 | 170.56 | C5H3ClN4O
Ambeed | 5-Fluoro-2-iodobenzaldehyde | 250mg | 600835302 | A250227 | 877264-44-3 | MFCD07782057 | 250.011 | C7H4FIO
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Caerulomycin A 25mg | 21802-37-9 | 229.24 g/mol | C12H11N3O2 | 25 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Caerulomycin A is a research-grade antibiotic small molecule with reported antifungal and immunomodulatory activity. It is supplied as a high-purity solid (CAS 21802-37-9) with molecular weight 229.24 g/mol and is commonly dissolved in DMSO for in vitro use or formulated for in vivo dosing.
- Antibiotic and antifungal activity observed in biological assays.
- Useful for in vitro and in vivo research applications.
- High purity: 98.0%.
- Molecular weight: 229.24 g/mol; formula C12H11N3O2.
- Soluble in DMSO (150 mg/mL); in vivo formulations documented at ≥2.5 mg/mL.
- Available in multiple pack sizes, including 25 mg.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Apexbio Technology LLC Chloroxine 773-76-2 50mg
Chloroxine (CAS 773-76-2) is a small-molecule agent that exerts antimicrobial antifungal and antiprotozoal activity by chelating metal ions essential for microbial proliferation thereby disrupting intracellular metal ion homeostasis and impairing critical metabolic pathways in pathogens Chloroxine demonstrates inhibitory activity with reported IC50 values typically ranging from submicromolar to low micromolar concentrations depending on the microorganism and assay conditions Based on these pharmacological properties chloroxine holds research potential in studies of intestinal amoebiasis pathogenesis experimental therapeutic evaluations and investigations of antifungal agents targeting fungi involved in dandruff and seborrheic dermatitis
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Naminidil | 220641-11-2 | MFCD30747839 | 99.6% | 269.34 g/mol | C15H19N5 | 100 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Naminidil is a cyanoguanidine-class ATP-sensitive potassium (KATP) channel opener supplied for research use. It is provided as a solid and as a DMSO solution for preclinical laboratory applications. Typical specifications include CAS 220641-11-2, molecular formula C15H19N5, molecular weight 269.34 g/mol, and high analytical purity. Intended use is limited to research; not for human or veterinary use.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Selleck Chemical LLC CarboxyaMidotriazole orotate S2975-5mg
Carboxyamidotriazole Orotate (L-651582 Orotate) is the orotate salt form of Carboxyamidotriazole (CAI) an orally bioavailable signal transduction inhibitor Carboxyamidotriazole Orotate is a cytostatic inhibitor of nonvoltage-operated calcium channels and calcium channel-mediated signaling pathways Carboxyamidotriazole Orotate inhibits angiogenesis tumor growth invasion and metastasis
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Apexbio Technology LLC Cetylpyridinium Chloride 123-03-5 50mg
Cetylpyridinium chloride (CAS 123-03-5) is a small-molecule inhibitor targeting microbial cell membranes It is designed to disrupt bacterial lipid bilayers thereby altering membrane permeability and inhibiting microbial viability Cetylpyridinium chloride exerts its biological activity primarily through membrane destabilization via positively charged cetylpyridinium ions interacting with negatively charged microbial surfaces In in vitro studies cetylpyridinium chloride demonstrates inhibitory activity with IC50 values ranging approximately between 0 5 to 10 M depending on microbial strain type and experimental conditions Based on these pharmacological properties cetylpyridinium chloride holds research potential in evaluating oral microbial inhibition biofilm formation interference and cell membrane-targeted antibacterial strategies
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-11034 10mg Medchemexpress, CVT-12012 CAS:1018675-35-8 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-11034 10mg CVT-12012 CAS:1018675-35-8 CVT-12012 is a potent and orally bioavailable stearoyl-coA desaturase (SCD) inhibitor, with IC50s of 38 nM, 6.1 nM for rat microsomal and human HEPG2, respectively. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Carbosynth LLC. Letrozole (USP grade powder), 200 mg
Letrozole (USP grade powder) chemical reference substance
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 2098546-05-3 | Medchem Express | EBI-2511 | 5mg | 441681833 | HY-111418 | 576.782 | C34H48N4O4
Ambeed | Sodium 23-dimercapto-1-propanesulfonate | 1g | 598442112 | A203975 | 4076-02-2 | MFCD00007523 | 210.260 | C3H7NaO3S3
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Azithromycin-d3 | 163921-65-1 | 98.0% | 752.00 | 1 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Azithromycin-d3 is the deuterium labeled Azithromycin, a macrolide antibiotic used for the treatment of various bacterial infections. It is suitable for applications requiring a tracer or an internal standard.
- Used as a tracer
- Used as an internal standard for quantitative analysis by NMR, GC-MS, or LC-MS
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-100888 50mg Medchemexpress, Simurosertib CAS:1330782-76-7 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-100888 50mg Simurosertib CAS:1330782-76-7 Simurosertib (TAK-931) is a selective cycle 7 (CDC7) kinase inhibitor, with an IC 50 <0.3 nM. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
![eMolecules 129319-91-1 | (2R)-tert-Butyl 2-methylaziridine-1-carboxylate | Synthonix - Stock | MFCD28098437 | 157.213 | C8H15NO2 | 97.000 | C[C@@H]1CN1C(=O)OC(C)(C)C | 500mg | 525932204](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502167908.JPG-250.jpg)
eMolecules 129319-91-1 | (2R)-tert-Butyl 2-methylaziridine-1-carboxylate | Synthonix - Stock | MFCD28098437 | 157.213 | C8H15NO2 | 97.000 | C[C@@H]1CN1C(=O)OC(C)(C)C | 500mg | 525932204
(2R)-tert-Butyl 2-methylaziridine-1-carboxylate | Synthonix - Stock | 129319-91-1 | MFCD28098437 | 157.213 | C8H15NO2 | 97.000 | C[C@@H]1CN1C(=O)OC(C)(C)C | 500mg | 525932204
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Cayman Chemical RoxIthromycIn 10g
A macrolide antibiotic; active against five strains EAch of Staphylococcus and Streptococcus (geometric mean MICs = 0.08 and 0.79 UG/ml, respectively), as well as several strains EAch of Corynebacterium, Haemophilus, and S. pneumoniae (MIC50s = 0.02, 0.01, and 2.5 UG/ml, respectively); protective against infection by strains of S. aureus, S. pyogenes, S. pneumoniae, or L. monocytogenes in mice (PD50s = 23-98 mg/kg)
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
CPC Scientific H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-OH (trifluoroacetate salt) 0.5MG
Peptide found to have anabolic effect on bone formation in rats that can inhibit the rapid decline in bone formation due to denervation.ONE-LETTER SEQUENCE: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAMOLECULAR FORMULA: C180H287N57O48MOLECULAR WEIGHT:4016.57STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [112955-31-4], RESEARCH AREA: OsteoporosisREFERENCES: L.J. Suva et al., Science, 237, 893 (1987)
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
![eMolecules 102518-79-6 | HUPERZINE A | AstaTech242.322 | C15H18N2O | 98.000 | C\C=C1/[C@@H]2Cc3[nH]c(=O)ccc3[C@@]1(N)CC(C)=C2 | 0.25g | 449795782](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502477035.JPG-250.jpg)
eMolecules 102518-79-6 | HUPERZINE A | AstaTech242.322 | C15H18N2O | 98.000 | C\C=C1/[C@@H]2Cc3[nH]c(=O)ccc3[C@@]1(N)CC(C)=C2 | 0.25g | 449795782
HUPERZINE A | AstaTech | 102518-79-6242.322 | C15H18N2O | 98.000 | C\C=C1/[C@@H]2Cc3[nH]c(=O)ccc3[C@@]1(N)CC(C)=C2 | 0.25g | 449795782
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More