Whole Blood Cells
Kingfisher Biotech Inc Bovine CCL14 Recombinant Protein
The Bovine CCL14 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL14 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CCL14 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL14 Specifications: (Molecular Weight: 15.3 kDa) (Amino Acid Sequence: SKNGSSSRGP YHPAECCLTY VSRPVPRQRV SSYYETSSQC PKPGIIFITK KGHYICANPR DGWVQDYIKE LEE (73)) (Gene ID: 616723). For research use only. Made in the USA
Kingfisher Biotech Inc Feline CCL8 Recombinant Protein
The Feline CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Feline CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Feline CCL8 Specifications: (Molecular Weight: 8.7 kDa) (Amino Acid Sequence: QPGSVSIPIT CCFSVVKGKI PMQKLESYTR ITNIQCPQEA VIFKTKTSRE ICADPKQKWV QDFMKRLDQK SQTQKP (76)) (Gene ID: 101097189). For research use only. Made in the USA
Kingfisher Biotech Inc Egyptian Rousette Bat M-CSF Recombinant Protein
The Egyptian Rousette Bat M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat M-CSF Specifications: (Molecular Weight: 18.8 kDa) (Amino Acid Sequence: KEESKHCSYMIGDGHLQLLQQLIDSQMETSCPISFEFVDKERLKDPVCYVKKAFFLVQEIMEDTVRFKDNTSNAHAILKLQELSVSLEACFPKDFEEKDKACVGNFSESPLQLLEKIKNFFNETKNLLKKDRNIFSKNCSNTFAQCSSQSHKPERLEPWPHG (162)) (Gene ID: 107516132). For research use only. Made in the USA
Kingfisher Biotech Inc Hamster CCL5 Recombinant Protein
The Hamster CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Hamster CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. Hamster CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Hamster CCL5 Specifications: (Molecular Weight: 8.1 kDa) (Amino Acid Sequence: SPRGSDTTPC CFDYLSFTLP RVHIKEYFYT SSKCSNFAVV FVTRRNRQVC ANPKKKWVQE YINYLEMK (68)) (Gene ID: 101832468). For research use only. Made in the USA
Kingfisher Biotech Inc Rabbit IL-36 alpha Recombinant Protein
The Rabbit IL-36 alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit IL-36 alpha applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit IL-36 alpha yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit IL-36 alpha Specifications: (Molecular Weight: 18.3 kDa) (Amino Acid Sequence: STPAPVLRHI QDLNHQVWVV QDQTLTAVPR KHSMVPATVS LIPCQYPETL ETEKGIPMYL GLDKPDVCLF CTKTREQPML QLEDKNIMTL YHHPEPVKPF LFYHSKSGRT STFESVAFPG WFIAVCSEGG CPLFLTQDLG KAYTTDFELT PVN (153)) (Gene ID: 100355520). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IL-7 Recombinant Protein
The Chicken IL-7 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-7 applications are for cell culture, ELISA standard, and Western Blot Control. Chicken IL-7 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-7 Specifications: (Molecular Weight: 18.5 kDa) (Amino Acid Sequence: SSCTMGNKTT EIRVKYENIL SHDIEELVNM SAEYRDRCCK NKRHEHNKVF FCNDTQEIGS LQSMACNMLR FFNKQKINKE FRRKAALVSC GTLQVLQCKC ERHKKEKVCT QVNAPNNEDT ETVEQPKKKC NQEFCELKEN ISSLRSCWNK FEKIISR (157)) (Gene ID: 420193). For research use only. Made in the USA
Kingfisher Biotech Inc Rabbit G-CSF Recombinant Protein
The Rabbit G-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit G-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit G-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit G-CSF Specifications: (Molecular Weight: 18.3 kDa) (Amino Acid Sequence: GPASSLPQGF LLKCSEQVRK IQADTSMLQE ELCATHKLCH PEELLLLGHS LGIPRAPLSS CSSQALQLPG CLSQLHSGLL LYRGLLQALA GISPASAPAL DKLQLDVADF ATTIWHQMED LGQAPAVQPT QSTMPALTSA FQRRAGSVLV ASHLQSFLEL TYRVLRYLAQ (170)) (Gene ID: 100356652). For research use only. Made in the USA
Kingfisher Biotech Inc Mouse IL-36 gamma Recombinant Protein
The Mouse IL-36 gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse IL-36 gamma applications are for cell culture, ELISA standard, and Western Blot Control. Mouse IL-36 gamma yeast-derived recombinant protein can be purchased in multiple sizes. Mouse IL-36 gamma Specifications: (Molecular Weight: 17.2 kDa) (Amino Acid Sequence: GRETPDFGEV FDLDQQVWIF RNQALVTVPR SHRVTPVSVT ILPCKYPESL EQDKGIAIYL GIQNPDKCLF CKEVNGHPTL LLKEEKILDL YHHPEPMKPF LFYHTRTGGT STFESVAFPG HYIASSKTGN PIFLTSKKGE YYNINFNLDI K (151)) (Gene ID: 215257). For research use only. Made in the USA
Kingfisher Biotech Inc Rabbit TWEAK (TNFSF12) Recombinant Protein
The Rabbit TWEAK yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit TWEAK applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit TWEAK yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit TWEAK Specifications: (Molecular Weight: 15.7 kDa) (Amino Acid Sequence: AAHYEVHPRP GQDGAQAGVD GTVSGWEEAK INSSNPLRYD RQIGKFIVTR AGLYYLYCQV HFDEGKAVYL KLDLLVDEVL ALRCLEEFSA TAASSLGPQL RLCQVSGLLP LRPGSSLRIR TLPWAHLKAA PFLTYFGLFQ VH (142)) (Gene ID: 100356651). For research use only. Made in the USA
Kingfisher Biotech Inc Egyptian Rousette Bat M-CSF Recombinant Protein
The Egyptian Rousette Bat M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat M-CSF Specifications: (Molecular Weight: 18.8 kDa) (Amino Acid Sequence: KEESKHCSYMIGDGHLQLLQQLIDSQMETSCPISFEFVDKERLKDPVCYVKKAFFLVQEIMEDTVRFKDNTSNAHAILKLQELSVSLEACFPKDFEEKDKACVGNFSESPLQLLEKIKNFFNETKNLLKKDRNIFSKNCSNTFAQCSSQSHKPERLEPWPHG (162)) (Gene ID: 107516132). For research use only. Made in the USA
Kingfisher Biotech Inc Jamaican fruit-eating Bat IFN gamma Recombinant Protein
The Jamaican Fruit-eating Bat IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Jamaican Fruit-eating Bat IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. Jamaican Fruit-eating Bat IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Jamaican Fruit-eating Bat IFN gamma Specifications: (Molecular Weight: 16.6 kDa) (Amino Acid Sequence: TFTTEIENLK EYFNASMSDV ADNETLFSNV LKKWKDESDR KIFQSQIVSF YFKLFDSLKD NQSIQSSVEV IKEDLRVKFF NSSNSKMEDF KKLIQIPVND LKVQRKAINE LIRVMHELTP GSNLRKRRRS PKLFHARSAS K (141)) (Gene ID: n/a). For research use only. Made in the USA
Kingfisher Biotech Inc Atlantic Salmon CCL28 Recombinant Protein
The Atlantic Salmon CCL28 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Atlantic Salmon CCL28 applications are for cell culture, ELISA standard, and Western Blot Control. Atlantic Salmon CCL28 yeast-derived recombinant protein can be purchased in multiple sizes. Atlantic Salmon CCL28 Specifications: (Molecular Weight: 8.1 kDa) (Amino Acid Sequence: GIPKCCVTTS MNIPTNVLRK VERAEMQRSN GVCDINALVL HVKGKKLCTH PKVKRKLKRM QRKKDGKPKR N (71)) (Gene ID: 100196449). For research use only. Made in the USA
Kingfisher Biotech Inc Hamster CCL5 Recombinant Protein
The Hamster CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Hamster CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. Hamster CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Hamster CCL5 Specifications: (Molecular Weight: 8.1 kDa) (Amino Acid Sequence: SPRGSDTTPC CFDYLSFTLP RVHIKEYFYT SSKCSNFAVV FVTRRNRQVC ANPKKKWVQE YINYLEMK (68)) (Gene ID: 101832468). For research use only. Made in the USA
Kingfisher Biotech Inc Egyptian Rousette Bat CCL8 Recombinant Protein
The Egyptian Rousette Bat CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat CCL8 Specifications: (Molecular Weight: 8.8 kDa) (Amino Acid Sequence: QPDSVSIPVT CCYNVIDIKI HIRKLKSYTR VTNSHCPQEA VIFKTKMDKE ICADPKEKWV QDSMKHLDKK SQTLKP (76)) (Gene ID: 107519945). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IL-3 Recombinant Protein
The Chicken IL-3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-3 applications are for cell culture, ELISA standard, and Western Blot Control. Chicken IL-3 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-3 Specifications: (Molecular Weight: 13.9 kDa) (Amino Acid Sequence: SPLPLDKDCP STSSLSEVIE DVEKLQGSNE AIPPNNIILM MEQGEENAVT YLEEFIRALE SSKKQIKKDF LRNLQKIYST GKNCTGWLIH NWEPMESDDF FKNFEELLKF LNMYGVSKKT S (121)) (Gene ID: 474356). For research use only. Made in the USA