Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

Search Within Results

136 – 150 of 1,893,045 results

136

Invitrogen™ SERCA1 ATPase Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	O14983, Q64578, Q8R429
Isotype	IgG
Concentration	500 μg/mL
Antigen	SERCA1 ATPase
Gene Symbols	ATP2A1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	adult Ca2+ ATPase; ATP2A; ATP2A1; ATP2A3; ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1; ATPase, Ca++ transporting, cardiac muscle, fast twitch 1; ATPase, Ca++ transporting, ubiquitous; Ca2+ ATPase; calcium pump 1; Calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle isoform; endoplasmic reticulum class 1/2 Ca(2+) ATPase; neonatal Ca2+ ATPase; sarcoplasmic/endoplasmic reticulum calcium ATPase 1; SERCA; SERCA ATPase; Serca1; SERCA1a; SR Ca(2+)-ATPase 1
Gene	ATP2A1
Product Type	Antibody
Gene ID (Entrez)	116601, 11937, 487
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human SERCA1 ATPase (1-32aa MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN).
Classification	Polyclonal
Primary or Secondary	Primary

137

Invitrogen™ ETS2 Recombinant Rabbit Monoclonal Antibody (HL2259)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P15036, P15037
Isotype	IgG
Concentration	1 mg/mL
Antigen	ETS2
Gene Symbols	ETS2
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	AU022856; avian erythroblastosis virus E26 (v-ets) oncogene homolog 2; E26 avian leukemia oncogene 2, 3' domain; ETS proto-oncogene 2, transcription factor; Ets2; Ets-2; ETS2IT1; oncogene ETS-2; protein C-ets-2; v-ets avian erythroblastosis virus E2 oncogene homolog 2; v-ets avian erythroblastosis virus E26 oncogene homolog 2; v-ets erythroblastosis virus E26 oncogene homolog 2
Gene	ETS2
Product Type	Antibody
Gene ID (Entrez)	2114, 23872
Formulation	PBS with no preservative
Immunogen	Recombinant fragment of human ETS2.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	HL2259

138

Invitrogen™ SGK1 Recombinant Superclonal™ Antibody (22HCLC)

Rabbit Recombinant Superclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	O00141, Q9WVC6
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	SGK1
Gene Symbols	SGK1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	serine/threonine protein kinase SGK; serine/threonine-protein kinase Sgk1; serum and glucocorticoid-dependent protein kinase; serum/glucocorticoid regulated kinase 1; serum/glucocorticoid-regulated kinase 1; Sgk; SGK1; Sgk1 variant i3
Gene	SGK1
Product Type	Antibody
Gene ID (Entrez)	20393, 6446
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Protein corresponding to human SGK1 (aa1-084).
Classification	Recombinant Superclonal
Primary or Secondary	Primary
Clone	22HCLC

139

Invitrogen™ MNK1 Recombinant Superclonal™ Antibody (6HCLC)

Rabbit Recombinant Superclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O08605, Q9BUB5
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	MNK1
Gene Symbols	MKNK1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	2410048M24Rik; MAP kinase interacting serine/threonine kinase 1; MAP kinase signal-integrating kinase 1; MAP kinase-interacting serine/threonine kinase 1; MAP kinase-interacting serine/threonine-protein kinase 1; MAPK signal-integrating kinase 1; MKNK1; Mnk1; OTTHUMP00000009675; OTTHUMP00000009676
Gene	MKNK1
Product Type	Antibody
Gene ID (Entrez)	17346, 8569
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Peptides corresponding to human MNK1 (aa38-μ, aa9-26).
Classification	Recombinant Superclonal
Primary or Secondary	Primary
Clone	6HCLC

140

Invitrogen™ EBI3 (IL-27 subunit) Monoclonal Antibody (ebic6), APC, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	Q14213
Isotype	IgG2b κ
Concentration	5 μL/Test
Antigen	EBI3 (IL-27 subunit)
Gene Symbols	EBI3
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	cytokine receptor; EBI3; EBI-3; EBV-induced gene 3 protein; Epstein-Barr virus induced 3; Epstein-Barr virus induced gene 3; Epstein-Barr virus induced gene 3 (similar to Interleukin-27 beta chain precursor); epstein-Barr virus-induced gene 3 protein; Epstein-Barr virus-induced gene 3 protein homolog; IL-27; IL27 subunit; IL-27 subunit beta; IL27B; IL-27B; IL35 subunit; interleukin-27 subunit beta
Gene	EBI3
Product Type	Antibody
Gene ID (Entrez)	10148
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Immunogen	Human IL-27 recombinant protein.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	ebic6

141

CD8a Monoclonal Antibody (53-6.7), Functional Grade, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Rat
Conjugate	Functional Grade
Applications	Flow Cytometry,Functional Assay,Neutralization
Form	Liquid
Isotype	IgG2a κ
Concentration	1 mg/mL
Antigen	CD8a
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene	Cd8a
Product Type	Antibody
Formulation	PBS with no preservative; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	53-6.7

142

Invitrogen™ CD80 Monoclonal Antibody (MEM-233), PE

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Human
Host Species	Mouse
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P33681
Isotype	IgG1
Antigen	CD80
Gene Symbols	CD80
Regulatory Status	ASR
Purification Method	Purified
Gene Alias	Activation B7-1 antigen; B7; B7 protein; B7.1; B71; B7-1; B7-1 protein; B7-1 protein precursor; BB1; B-lymphocyte activation antigen B7; Cd28l; CD28LG; CD28LG1; CD80; Cd80 a rat homolog of the human CD28/CTLA - 4 ligand (B7-1); CD80 anitgen; CD80 antigen; CD80 antigen (CD28 antigen ligand 1, B7-1 antigen); Cd80 molecule; CD80 protein precursor; costimulatory factor CD80; costimulatory molecule variant IgV-CD80; CTLA-4 counter-receptor B7.1; LAB7; Ly53; Ly-53; MIC17; sCD 80; sCD80; secreted B7-1 protein precursor; soluble CD 80; soluble CD80; T-cell costimulatory molecule; T-cell co-stimulatory protein B7-1; T-lymphocyte activation antigen CD80; TS/A-1; TSA1
Gene	CD80
Product Type	Antibody
Gene ID (Entrez)	941
Formulation	PBS with 4mg/mL BSA, sucrose and 0.1% sodium azide
Immunogen	Human CD80.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MEM-233

143

Invitrogen™ FGF13 Monoclonal Antibody (N235/22)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (PFA fixed),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P70377, Q92913, Q9ERW3
Isotype	IgG2b
Concentration	1 mg/mL
Antigen	FGF13
Gene Symbols	FGF13
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	AFGF; ECGF; ECGFA; ECGFB; FGF; FGF 1; FGF alpha; FGF13; FGF-13; FGF13A; FGF2; FGFA; Fhf2; FHF-2; Fibroblast growth factor; fibroblast growth factor 13; Fibroblast growth factor homologous factor 2; GLIO703; HBGF 1; HBGF1
Gene	FGF13
Product Type	Antibody
Gene ID (Entrez)	14168, 2258, 84488
Formulation	PBS with 50% glycerol and 0.1% sodium azide; pH 7.4
Immunogen	Synthetic peptide amino acids 2-18 (AAAIASSLIRQKRQARE) of human FHF2A. 100% identical to rat, 94% identical to mouse. >80% identity with FGF12A/FHF1A, FGF14A/FHF4A and FGF11A/FHF3A.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	N235/22

144

Invitrogen™ ATP1A1 Monoclonal Antibody (M7-PB-E9), Alexa Fluor™ 555

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Bovine,Canine,Chicken,Human,Mouse,Sheep,Pig,Rat
Host Species	Mouse
Conjugate	Alexa Fluor 555
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Immunocytochemistry
Form	Liquid
Gene Accession No.	P04074, P05023, P05024, P06685, P09572, P50997, Q08DA1, Q8VDN2
Isotype	IgG1
Concentration	1 mg/mL
Antigen	ATP1A1
Gene Symbols	ATP1A1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	(Na+ + K+)-ATPase; (Na+, K+)-ATPase alpha-subunit; alpha subunit of sodium potassium ATPase; atp1a1; atp1a1-a; atp1a1a.4; atp1a1-b; ATP1B; Atpa-1; ATPase; ATPase Na+/K+ transporting subunit alpha 1; ATPase, Na+/K+ transporting, alpha 1 polypeptide; ATPase, Na+K+ transporting, alpha 1; BC010319; K-ATPase; MGC1798; Na(+)/K(+) ATPase alpha-1 subunit; Na, K-ATPase alpha-1 subunit; Na, K-ATPase, alpha-A catalytic polypeptide; Na,K-ATPase alpha-1 subunit; Na,K-ATPase catalytic subunit alpha-A protein; Na/K ATPase alpha 1 isoform; Na/K ATPase alpha 1 subunit; Na+ ,K+ -ATPase alpha subunit; Na+ /K+ ATPase alpha 1 subunit; Na+, K+-ATPase beta-subunit precursor; Na+/K+ ATPase; Na+/K+ ATPase 1; Na+/K+ ATPase Alpha; Na+/K+ -ATPase alpha 1 subunit; Na+/K+ transporting alpha 1 polypeptide; Na+K+ ATPase; Na+K+ATPase; Nkaa1b; RP4-655J12.1; sarcolemmal sodium/potassium-ATPase alpha 1; Sodium Potassium ATPase; sodium pump 1; sodium pump subunit alpha-1; sodium/potassium-ATPase alpha-subunit 1; sodium/potassium-transporting ATPase alpha-1 chain; sodium/potassium-transporting ATPase subunit alpha-1; sodium-potassium ATPase catalytic subunit alpha-1; sodium-potassium-ATPase, alpha 1 polypeptide; unnamed protein product
Gene	ATP1A1
Product Type	Antibody
Gene ID (Entrez)	11928, 24211, 282144, 396530, 397481, 403992, 443381, 476
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.4
Immunogen	Purified alpha sodium/potassium ATPase from sheep kidney.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	M7-PB-E9

145

IL-10 Monoclonal Antibody (JES3-9D7), PerCP-eFluor™ 710, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Rat
Conjugate	PerCP-eFluor 710
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P22301
Concentration	5 μL/Test
Antigen	IL-10
Gene Symbols	IL10
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CSIF; cytokine; Cytokine synthesis inhibitory factor; GVHDS; H-IL-10; il 10; IL10; IL-10; IL-10 precursor; IL10A; IL10X; ILN; Interleukin; interleukin 10; Interleukin10; interleukin-10; MGC126450; MGC126451; RP11-262N9.1; T-cell growth inhibitory factor; TGIF
Gene	IL10
Product Type	Antibody
Gene ID (Entrez)	3586
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	JES3-9D7

146

Invitrogen™ PTGES Recombinant Rabbit Monoclonal Antibody (13H2L6)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	O14684, Q9JM51
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	PTGES
Gene Symbols	PTGES
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	2410099E23Rik; D2Ertd369e; glutathione S-transferase 1-like 1; MGST1L1; MGST1-L1; MGST1-like 1; MGST-IV; Microsomal glutathione S-transferase 1-like 1; microsomal prostaglandin E synthase 1; microsomal prostaglandin E synthase-1; MPGES; MPGES1; mPGES-1; p53-induced apoptosis protein 12; p53-induced gene 12 protein; Pges; PIG12; PP102; PP1294; Prostaglandin E synthase; PTGES; TP53I12; tumor protein p53 inducible protein 12
Gene	PTGES
Product Type	Antibody
Gene ID (Entrez)	64292, 9536
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Peptides corresponding to human PTGES [1) aa42-aa58 2) aa1-aa12].
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	13H2L6

147

CD185 (CXCR5) Monoclonal Antibody (MU5UBEE), Brilliant Ultra Violet™ 737, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Monkey,Rhesus Macaque
Host Species	Mouse
Conjugate	Brilliant Ultraviolet 737
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2b κ
Gene Accession No.	P32302
Concentration	5 μL/Test
Antigen	CD185 (CXCR5)
Gene Symbols	CXCR5
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Blr1; Blr-1; Burkitt lymphoma receptor 1; burkitt lymphoma receptor 1 homolog; Burkitt lymphoma receptor 1, GTP binding protein (chemokine (C-X-C motif) receptor 5); Burkitt lymphoma receptor 1, GTP-binding protein; C Cmotif chemokine; C X C motif chemokine; CC motif chemokine; CCmotif chemokine; CD185; CD185 antigen; chemochine (C-X-C motif) receptor 5; chemokine (C-X-C motif) receptor 5; CXC; C-X-C chemokine receptor type 5; CXC motif chemokine; C-X-C motif chemokine receptor 5; CXCR5; CXC-R5; CXCR-5; EGK_06966; Fusin; Gpcr6; GPR9; HUMSTR; LESTR; MDR15; MDR-15; Monocyte-derived receptor 15; neurolymphatic receptor; NLR
Gene	CXCR5
Gene ID (Entrez)	643, 701792
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Immunogen	N-terminal extracellular domain.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MU5UBEE

148

Invitrogen™ CXCR6 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Maintain refrigerated at 2-8°C for up to 3 months. For long term storage store at -20°C
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Western Blot
Form	Liquid
Gene Accession No.	O00574
Isotype	IgG
Concentration	1 mg/mL
Antigen	CXCR6
Gene Symbols	CXCR6
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	BB217514; BONZO; C Cmotif chemokine; C X C motif chemokine; CC motif chemokine; CCmotif chemokine; CD186; CD186 antigen; CDw186; chemokine (C-X-C motif) receptor 6; chemokine receptor CXCR6; CXC; C-X-C chemokine receptor type 6; CXC motif chemokine; C-X-C motif chemokine receptor 6; Cxcr6; CXC-R6; CXCR-6; G protein-coupled receptor; G-protein coupled receptor bonzo; G-protein coupled receptor STRL33; OTTHUMP00000209997; OTTHUMP00000209998; STRL33; TYMSTR
Gene	CXCR6
Product Type	Antibody
Gene ID (Entrez)	10663
Formulation	PBS with 0.02% sodium azide
Immunogen	A peptide corresponding to amino acids near the amino terminus of human Bonzo/STRL33.
Classification	Polyclonal
Primary or Secondary	Primary

149

Invitrogen™ Phospho-PAK4/6/7 (Ser474) Recombinant Superclonal™ Antibody

Rabbit Recombinant Superclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O96013, Q9NQU5, Q9P286
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	Phospho-PAK4/6/7 (Ser474)
Gene Symbols	Pak4, PAK5, PAK6
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	2900083L08Rik; 4732456M09; 5730488L07Rik; 6430627N20; AW555722; KIAA1142; KIAA1264; mKIAA1142; p21 (CDKN1A)-activated kinase 4; p21 (CDKN1A)-activated kinase 6; p21 (CDKN1A)-activated kinase 7; p21 (RAC1) activated kinase 4; p21 (RAC1) activated kinase 5; p21 (RAC1) activated kinase 6; p21 (RAC1) activated kinase 7; p21 protein (Cdc42/Rac)-activated kinase 4; p21 protein (Cdc42/Rac)-activated kinase 6; p21 protein (Cdc42/Rac)-activated kinase 7; p21(CDKN1A)-activated kinase 4; p21(CDKN1A)-activated kinase 6; p21(CDKN1A)-activated kinase 7; p21-activated kinase 4; p21-activated kinase 5; p21-activated kinase 6; p21-activated kinase 7; p21CDKN1A-activated kinase 7; PAK 4/5/6; PAK 4/6/7; PAK4; PAK-4; PAK4/5/6; PAK5; PAK-5; PAK6; PAK-6; Pak7; PAK-7; protein kinase PAK5; protein kinase related to S. cerevisiae STE20, effector for Cdc42Hs; serine/threonine-protein kinase PAK 4; Serine/threonine-protein kinase PAK 5; serine/threonine-protein kinase PAK 6; serine/threonine-protein kinase PAK 6-like; serine/threonine-protein kinase PAK 7; serine/threonine-protein kinase PAK7
Gene	Pak4
Product Type	Antibody
Gene ID (Entrez)	10298, 56924, 57144
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Peptide corresponding to human Phospho-PAK4/PAK5/PAK6 (Ser474) (aa472-aa480).
Classification	Recombinant Superclonal
Primary or Secondary	Primary

150

Invitrogen™ CCR3 Recombinant Superclonal™ Antibody (23HCLC)

Rabbit Recombinant Superclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunocytochemistry
Form	Liquid
Gene Accession No.	P51677
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	CCR3
Gene Symbols	CCR3
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	b-chemokine receptor; CC chemokine receptor 3; C-C chemokine receptor type 3; C-C CKR-3; C-C motif chemokine receptor 3; CC-CKR3; CC-CKR-3; Ccr3; CCR-3; CD193; chemokine (C-C motif) receptor 3; chemokine (C-C) receptor 1,-like 2; chemokine (C-C) receptor 3; CKR3; Cmkbr1l2; CMKBR3; eosinophil CC chemokine receptor 3; eosinophil eotaxin receptor; Macrophage inflammatory protein 1-alpha receptor-like 2; MGC102841; MIP-1 alpha RL2; MIP-1 alphaRL2; probable C-C chemokine receptor type 3
Gene	CCR3
Product Type	Antibody
Gene ID (Entrez)	1232
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Peptides corresponding to Human CCR3 (aa 337-355, 172-190).
Classification	Recombinant Superclonal
Primary or Secondary	Primary
Clone	23HCLC

Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ SERCA1 ATPase Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ETS2 Recombinant Rabbit Monoclonal Antibody (HL2259) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ EBI3 (IL-27 subunit) Monoclonal Antibody (ebic6), APC, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD8a Monoclonal Antibody (53-6.7), Functional Grade, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD80 Monoclonal Antibody (MEM-233), PE Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ FGF13 Monoclonal Antibody (N235/22) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ATP1A1 Monoclonal Antibody (M7-PB-E9), Alexa Fluor™ 555 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

IL-10 Monoclonal Antibody (JES3-9D7), PerCP-eFluor™ 710, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD185 (CXCR5) Monoclonal Antibody (MU5UBEE), Brilliant Ultra Violet™ 737, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CXCR6 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SERCA1 ATPase Polyclonal Antibody

Invitrogen™ ETS2 Recombinant Rabbit Monoclonal Antibody (HL2259)

Invitrogen™ EBI3 (IL-27 subunit) Monoclonal Antibody (ebic6), APC, eBioscience™

CD8a Monoclonal Antibody (53-6.7), Functional Grade, eBioscience™, Invitrogen™

Invitrogen™ CD80 Monoclonal Antibody (MEM-233), PE

Invitrogen™ FGF13 Monoclonal Antibody (N235/22)

Invitrogen™ ATP1A1 Monoclonal Antibody (M7-PB-E9), Alexa Fluor™ 555

IL-10 Monoclonal Antibody (JES3-9D7), PerCP-eFluor™ 710, eBioscience™, Invitrogen™

CD185 (CXCR5) Monoclonal Antibody (MU5UBEE), Brilliant Ultra Violet™ 737, eBioscience™, Invitrogen™

Invitrogen™ CXCR6 Polyclonal Antibody