Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

Search Within Results

451 – 465 of 1,659,610 results

451

Phospho-Jak2 (Tyr1007, Tyr1008) Recombinant Rabbit Monoclonal Antibody (JAK2Y10071008-PB6), FITC, Invitrogen™

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Human
Host Species	Rabbit
Conjugate	FITC
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG κ
Gene Accession No.	O60674
Antigen	Phospho-Jak2 (Tyr1007, Tyr1008)
Gene Symbols	JAK2
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	EC 2.7.10.2; Fd17; JAK 2; JAK2; JAK-2; Janus kinase 2; Janus kinase 2 (a protein tyrosine kinase); JTK 10; JTK10; kinase Jak2; THCYT3; Tyrosine-protein kinase JAK2
Gene	JAK2
Product Type	Antibody
Gene ID (Entrez)	3717
Formulation	PBS with 0.20% BSA and 0.09% sodium azide
Immunogen	A synthetic phospho-peptide corresponding to residues surrounding Tyr1007/Tyr1008 of human phospho Jak2.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	JAK2Y10071008-PB6

452

Invitrogen™ Feline Leukemia Virus Monoclonal Antibody (YCH)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C
Target Species	Virus
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunoprecipitation,Radioimmune Assays (RIA)
Form	Liquid
Isotype	IgG1
Concentration	1 mg/mL
Antigen	Feline Leukemia Virus
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	FLV
Product Type	Antibody
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.4
Immunogen	Viral coat antigen.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	YCH

453

Invitrogen™ Phospho-DNA-PK (Thr2609) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Human,Non-human Primate
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ChIP Assay,ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P78527
Isotype	IgG
Concentration	0.93 mg/mL
Antigen	Phospho-DNA-PK (Thr2609)
Gene Symbols	PRKDC
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI326420; AU019811; DNA-dependent protein kinase catalytic subunit; DNAPDcs; DNAPK; DNA-PK catalytic subunit; DNA-PKcs; DNPK1; DOXNPH; doxorubicin nephropathy; dxnph; hyper-radiosensitivity of murine scid mutation, complementing 1; HYRC; HYRC1; I79_017613; IMD26; p350; p460; Prkdc; protein kinase, DNA activated, catalytic polypeptide; protein kinase, DNA-activated, catalytic polypeptide; scid; severe combined immunodeficiency; slip; Xrcc7
Gene	PRKDC
Product Type	Antibody
Gene ID (Entrez)	5591
Formulation	PBS with 0.01% sodium azide; pH 7.2
Immunogen	Synthetic peptide corresponding to amino acids surrounding Thr 2609 of human DNA PKcs.
Classification	Polyclonal
Primary or Secondary	Primary

454

CD25 Rat anti-Mouse, Biotin, Clone: 7D4, BD

Rat Monoclonal Antibody

Pricing & Availability

455

Invitrogen™ CD365 (TIM1) Monoclonal Antibody (RMT1-10)

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Mouse
Host Species	Rat
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q5QNS5
Isotype	IgG2a
Concentration	1 mg/mL
Antigen	CD365 (TIM1)
Gene Symbols	Havcr1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	AI503787; CD365; HAVCR; HAVCR1; HAVcr-1; Hepatitis A virus cellular receptor 1; hepatitis A virus cellular receptor 1 homolog; Kidney injury molecule 1; Kim1; KIM-1; T cell immunoglobin domain and mucin domain protein 1; t cell immunoglobulin and mucin domain-containing protein 1; T cell membrane protein 1; T-cell immunoglobulin and mucin domain containing 1; T-cell immunoglobulin and mucin domain-containing protein 1; T-cell immunoglobulin mucin family member 1; T-cell immunoglobulin mucin receptor 1; T-cell membrane protein 1; TIM; TIM1; TIM-1; TIMD1; TIMD-1
Gene	Havcr1
Product Type	Antibody
Gene ID (Entrez)	171283
Formulation	PBS with 0.09% sodium azide
Immunogen	Full-length mouse Tim-1-Ig, containing both the IgV and mucin domains of Tim-1.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	RMT1-10

456

Invitrogen™ IkB zeta Recombinant Rat Monoclonal Antibody (LK2NAP), Alexa Fluor™ Plus 647

Rat Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Alexa Fluor Plus 647
Applications	Flow Cytometry,Western Blot
Form	Liquid
Gene Accession No.	Q9EST8
Isotype	IgG2a κ
Concentration	1.0 mg/mL
Antigen	IkB zeta
Gene Symbols	NFKBIZ
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AA408868; FLJ30225; FLJ34463; Ikappa B-zeta variant 3; ikappaBzeta; I-kappa-B-zeta; IkappaB-zeta; IKBZ; ikB-zeta; IL-1 inducible nuclear ankyrin-repeat protein; INAP; Mail; molecule possessing ankyrin repeats induced by lipopolysaccharide; molecule possessing ankyrin-repeats induced by lipopolysaccharide; NF-kappa-B inhibitor zeta; NFKB inhibitor zeta; NFKBIZ; nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, zeta; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta; OTTHUMP00000214340; RGD1310834
Gene	NFKBIZ
Product Type	Antibody
Gene ID (Entrez)	80859
Formulation	Proprietary buffer with 0.008% Bromonitrodioxane, 0.008% Methylisothiazolone; pH 6.8
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	LK2NAP

457

Invitrogen™ Chikungunya Virus E1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Virus
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	1.02 mg/mL
Antigen	Chikungunya Virus E1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Chikungunya Virus
Product Type	Antibody
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of Chikungunya virus E1 (Chikungunya virus (strain S27-African prototype)). The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

458

Invitrogen™ CD56 (NCAM) Recombinant Mouse Monoclonal Antibody (TULY56), Alexa Fluor™ Plus 555

Mouse Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Alexa Fluor Plus 555
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P13591
Isotype	IgG1 κ
Concentration	1 mg/mL
Antigen	CD56 (NCAM)
Gene Symbols	Ncam1
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	adhesion molecule; antigen recognized by monoclonal antibody 5.1H11; Cd56; CD-56; CD56 120 kDa GPI-linked isoform; CD56 140 kDa isoform; CD56 140 kDa VASE isoform; E NCAM; E-NCAM; MSK39; N CAM1; NCAM; N-CAM; Ncam1; N-CAM-1; NCAM-1; NCAMC; NCAM-C; neural cell adhesion molecule; Neural cell adhesion molecule 1; neural cell adhesion molecule, NCAM; sCD56; sNCAM; soluble CD56; soluble NCAM
Gene	Ncam1
Product Type	Antibody
Gene ID (Entrez)	4684
Formulation	Proprietary buffer with 0.008% Bromonitrodioxane, 0.008% Methylisothiazolone; pH 6.3-7.3
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	TULY56

459

Invitrogen™ ACACB Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	E9Q4Z2, O00763
Isotype	IgG
Concentration	500 μg/mL
Antigen	ACACB
Gene Symbols	ACACB
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Acacb; Acc2; ACCB; ACC-beta; acetyl-CoA carboxylase 2; acetyl-CoA carboxylase beta; acetyl-Coenzyme A carboxylase 2; acetyl-Coenzyme A carboxylase beta; AI597064; AW743042; Biotin carboxylase; HACC275
Gene	ACACB
Product Type	Antibody
Gene ID (Entrez)	100705, 116719, 32
Formulation	PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence of human Acetyl Coenzyme A Carboxylase/ACACB (EENPEVAVDCVIYLSQHISPAERAQVVHLLSTMD).
Classification	Polyclonal
Primary or Secondary	Primary

460

Invitrogen™ Phospho-4EBP1 (Thr37) Recombinant Rabbit Monoclonal Antibody (52H37L2)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q13541
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	Phospho-4EBP1 (Thr37)
Gene Symbols	EIF4EBP1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	4EBP1; 4E-BP1; AA959816; BP-1; eIF4E-binding protein 1; EIF4EBP1; eukaryotic translation initiation factor 4E binding protein 1; eukaryotic translation initiation factor 4E-binding protein 1; MGC431; MGC4316; P/OKCL.6; PHAS-1; PHAS-I; Phosphorylated heat- and acid-stable protein regulated by insulin 1
Gene	EIF4EBP1
Product Type	Antibody
Gene ID (Entrez)	1978
Formulation	PBS with 0.09% sodium azide
Immunogen	A peptide corresponding to amino acids 31-41 of Q13541.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	52H37L2

461

Invitrogen™ CTLA-4 Recombinant Superclonal™ Antibody (11HCLC)

Rabbit Recombinant Superclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunocytochemistry
Form	Liquid
Gene Accession No.	P16410
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	CTLA-4
Gene Symbols	CTLA4
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	ALPS5; CD; CD152; CD152 antigen; CD152 isoform; CD152 protein; CD152 protein precursor; celiac disease 3; CELIAC3; Ctla4; CTLA-4; cytotoxic T lymphocyte associated antigen 4 short spliced form; cytotoxic T-lymphocyte associated protein 4; cytotoxic T-lymphocyte protein 4; cytotoxic T-lymphocyte protein 4 isoform CTLA4-TM; cytotoxic T-lymphocyte-associated antigen 4; cytotoxic T-lymphocyte-associated protein 4; cytotoxic T-lymphocyte-associated serine esterase-4; EGK_04712; GRD4; GSE; ICOS; IDDM12; insulin-dependent diabetes mellitus 12; ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4; Ly-56; sCTLA4; soluble form; transmembrane form
Gene	CTLA4
Product Type	Antibody
Gene ID (Entrez)	1493
Formulation	PBS with 0.09% sodium azide; pH 7.4
Immunogen	Protein corresponding to Human CTLA4 (aa 186-223).
Classification	Recombinant Superclonal
Primary or Secondary	Primary
Clone	11HCLC

462

Invitrogen™ IL-1 beta Recombinant Superclonal™ Antibody (17HCLC)

Rabbit Recombinant Superclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P01584, P10749
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	IL-1 beta
Gene Symbols	IL1B
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	catabolin; cytokine; Hematopoietin 1 (H1); IFN beta inducing factor; il 1b; IL 1β; IL-1; IL1 B; IL-1 beta; IL-1 precursor; IL1B; IL-1B; IL1B1; IL1beta; IL-1beta; IL1-BETA; IL1F2; IL1β; ILN; Interleukin; interleukin 1 beta; Interleukin 1 beta precursor; interleukin 1, beta; interleukin 1, beta 1; interleukin 1-beta; interleukin1beta; Interleukin1 beta; interleukin-1 beta; interleukin-1 beta precursor; interleukin-1 beta precursor (AA -113 to 153); interleukin-1 beta proprotein; interleukin-1b; interleukin-1beta; interleukin-beta; LAF; lymphocyte proliferation-potentiating factor; Osteoclast activating factor (OAF); preinterleukin 1 beta; Pro interleukin 1 beta; prointerleukin-1 beta; pro-interleukin-1-beta
Gene	IL1B
Product Type	Antibody
Gene ID (Entrez)	16176, 3553
Formulation	PBS with 0.09% sodium azide
Immunogen	Recombinant protein corresponding to amino acids 118-269 of mouse IL-1b.
Classification	Recombinant Superclonal
Primary or Secondary	Primary
Clone	17HCLC

463

Invitrogen™ GBX2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P48031, P52951
Isotype	IgG
Concentration	0.41 mg/mL
Antigen	GBX2
Gene Symbols	GBX2
Regulatory Status	RUO
Purification Method	Antigen Affinity Chromatography
Gene Alias	D130058E05Rik; gastrulation and brain-specific homeobox protein 2; gastrulation brain homeobox 2; Gbx2; Gbx-2; Homeobox protein GBX-2; LOW QUALITY PROTEIN: homeobox protein GBX-2; MMoxA; Stimulated by retinoic acid gene 7 protein; Stra7
Gene	GBX2
Product Type	Antibody
Gene ID (Entrez)	114500, 14472, 2637
Formulation	PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human GBX2. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

464

Invitrogen™ VTA1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q9NP79
Isotype	IgG
Concentration	0.74 mg/mL
Antigen	VTA1
Gene Symbols	VTA1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	1110001D18Rik; 1110059P08Rik; AU040813; C6orf55; C85340; chromosome 6 open reading frame 55; dopamine-responsive gene 1 protein; DRG1; DRG-1; homolog of mouse SKD1-binding protein 1; HSPC228; LIP5; lysosomal trafficking regulator interacting protein-5; LYST-interacting protein 5; My012; RGD1305031; SBP1; similar to 1110059P08Rik protein; SKD1 binding protein 1; SKD1-binding protein 1; Vacuolar protein sorting-associated protein VTA1 homolog; vesicle (multivesicular body) trafficking 1; vesicle trafficking 1; Vps20-associated 1 homolog; Vps20-associated 1 homolog (S. cerevisiae); Vta1; wu:fb08c11; zgc:64104
Gene	VTA1
Product Type	Antibody
Gene ID (Entrez)	51534
Formulation	0.1M tris glycine with 10% glycerol and 0.01% thimerosal; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human VTA1. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

465

Invitrogen™ La Crosse Virus Monoclonal Antibody (10G5.4)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Virus
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunoprecipitation,Neutralization,Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG2a
Concentration	1.3 mg/mL
Antigen	La Crosse Virus
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	LCV
Product Type	Antibody
Formulation	PBS with no preservative; pH 7.4
Immunogen	La Crosse Virus grown on E6 Vero cells and purified by sucrose gradient centrifugation.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	10G5.4

Prev
1
...
29
30
31
32
...
110,641
Next

Antibodies

Filtered Search Results

Narrow Results

Phospho-Jak2 (Tyr1007, Tyr1008) Recombinant Rabbit Monoclonal Antibody (JAK2Y10071008-PB6), FITC, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Feline Leukemia Virus Monoclonal Antibody (YCH) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Phospho-DNA-PK (Thr2609) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD365 (TIM1) Monoclonal Antibody (RMT1-10) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Chikungunya Virus E1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ACACB Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GBX2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ VTA1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ La Crosse Virus Monoclonal Antibody (10G5.4) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Phospho-Jak2 (Tyr1007, Tyr1008) Recombinant Rabbit Monoclonal Antibody (JAK2Y10071008-PB6), FITC, Invitrogen™

Invitrogen™ Feline Leukemia Virus Monoclonal Antibody (YCH)

Invitrogen™ Phospho-DNA-PK (Thr2609) Polyclonal Antibody

Invitrogen™ CD365 (TIM1) Monoclonal Antibody (RMT1-10)

Invitrogen™ Chikungunya Virus E1 Polyclonal Antibody

Invitrogen™ ACACB Polyclonal Antibody

Invitrogen™ GBX2 Polyclonal Antibody

Invitrogen™ VTA1 Polyclonal Antibody

Invitrogen™ La Crosse Virus Monoclonal Antibody (10G5.4)