Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

2,881 – 2,895 of 1,820,567 results

2,881

Invitrogen™ TRPM2 Polyclonal Antibody

Goat Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Goat
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Immunocytochemistry
Form	Liquid
Gene Accession No.	O94759
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	TRPM2
Gene Symbols	TRPM2
Regulatory Status	RUO
Purification Method	Ammonium sulfate precipitation
Gene Alias	9830168K16Rik; C79133; EC 3.6.1.13; EREG 1; EREG1; Estrogen-responsive element-associated gene 1 protein; KNP 3; KNP3; Long transient receptor potential channel 2; LTRPC 2; LTRPC2; LTrpC-2; MGC133383; NUDT9H; NUDT9L1; null; transient receptor potential cation channel subfamily M member 2; transient receptor potential cation channel, subfamily M, member 2; transient receptor potential channel 7; Transient receptor potential melastatin 2; transient receptor potential melastatin family 2; transient receptor protein 7; Trp7; TRPC 7; TRPC7; TRPM 2; Trpm2; Trpm2-predicted; Trrp7
Gene	TRPM2
Product Type	Antibody
Gene ID (Entrez)	7226
Formulation	TBS with 0.5% BSA and 0.02% sodium azide; pH 7.3
Immunogen	Peptide with sequence C-QQKQRPEQKIED.
Classification	Polyclonal
Primary or Secondary	Primary

2,882

Invitrogen™ SOX10 Recombinant Rabbit Monoclonal Antibody (PDH0-04)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O55170, P56693, Q04888
Isotype	IgG
Concentration	1 mg/mL
Antigen	SOX10
Gene Symbols	SOX10
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	cls; cls/sox10; colorless; colourless; colourless/sox10; DOM; dominant megacolon; dominant megacolon, mouse, human homolog of; golas; gos; HMG-box transcription factor Sox10; MGC15649; PCWH; Protein SOX-21; SOX10; Sox-10; sox10 protein; sox10b; Sox21; SOX9; SRY; SRY (sex determining region Y)-box 10; SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal); SRY box 10; SRY-box 10; SRY-box containing gene 10; SRY-box containing protein 10; SRY-box transcription factor 10; SRY-related HMG-box gene 10; transcription factor SOX-10; Transcription factor SOX-M; WS2E; WS4; WS4C; zgc:100757
Gene	SOX10
Product Type	Antibody
Gene ID (Entrez)	20665, 29361, 6663
Formulation	PBS with 0.1% BSA, 40% glycerol and 0.05% sodium azide; pH 7.4
Immunogen	Synthetic peptide within C terminal human SOX10.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	PDH0-04

2,883

Invitrogen™ CD304 (Neuropilin-1) Monoclonal Antibody (3DS304M), PE, eBioscience™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P97333
Isotype	IgG2a κ
Concentration	0.2 mg/mL
Antigen	CD304 (Neuropilin-1)
Gene Symbols	NRP1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	A5 protein; BDCA4; C530029I03; CD304; Neuropilin; neuropilin 1; Neuropilin1; neuropilin-1; Neuropilin-1 precursor (A5 protein); NP1; NP-1; Npn1; NPN-1; NRP; NRP 1; Nrp1; sNRP 1; sNRP1; soluble NRP 1; soluble NRP1; transmembrane receptor; vascular endothelial cell growth factor 165 receptor; VEGF165R
Gene	NRP1
Product Type	Antibody
Gene ID (Entrez)	18186
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	3DS304M

2,884

Invitrogen™ PD-1 (CD279) Recombinant Rabbit Monoclonal Antibody (RM309), Alexa Fluor™ Plus 647

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Human
Host Species	Rabbit
Conjugate	Alexa Fluor Plus 647
Applications	Immunohistochemistry (Paraffin),Multiplex Immunohistochemistry
Form	Liquid
Gene Accession No.	Q15116
Isotype	IgG
Concentration	0.2 mg/mL
Antigen	PD-1 (CD279)
Gene Symbols	Pdcd1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	CD279; EGK_05005; hPD1; hPD-1; hPD-l; hSLE1; Ly101; mPD-1; PD1; PD-1; Pdc1; Pdcd1; programmed cell death 1; programmed cell death 1 protein; programmed cell death protein 1; programmed cell death protein 1-like; programmed death 1; Protein PD1; protein PD-1; sCD279; SLEB2; soluble CD279; systemic lupus erythematosus susceptibility 2
Gene	Pdcd1
Product Type	Antibody
Gene ID (Entrez)	5133
Formulation	PBS with 0.5% BSA, 10% proprietary stabilizer and 0.05% sodium azide; pH 7.2
Immunogen	A peptide corresponding to the N-terminus of human PD-1.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	RM309

2,885

CD206 (MMR) Monoclonal Antibody (19.2), PerCP-eFluor™ 710, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	PerCP-eFluor 710
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P22897
Concentration	5 μL/Test
Antigen	CD206 (MMR)
Gene Symbols	Mrc1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AW259686; bA541I19.1; CD206; CELE_Y39A3CR.4; CLEC13D; CLEC13DL; C-type lectin domain family 13 member D; C-type lectin domain family 13 member D-like; ddp-1; hMR; Human mannose receptor; macrophage mannose receptor 1; Macrophage mannose receptor 1-like protein 1; mannose receptor, C type 1; mannose receptor, C type 1-like 1; Mitochondrial import inner membrane translocase subunit Tim8; MMR; MR; MRC1; MRC1L1; tim-8; Y39A3CR.4
Gene	Mrc1
Product Type	Antibody
Gene ID (Entrez)	4360
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	19.2

2,886

Invitrogen™ CD41a Monoclonal Antibody (eBioMWReg30 (MWReg30)), APC-eFluor™ 780, eBioscience™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	APC-eFluor 780
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	Q9QUM0
Isotype	IgG1 κ
Concentration	0.2 mg/mL
Antigen	CD41a
Gene Symbols	Itga2b
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI172977; alpha IIb; alphaIIb; alphaIIb protein; BDPLT16; BDPLT2; CD41; CD41B; form 1; form 2; GP IIb; GP2B; GPalpha IIb; GPIIb; GT; GTA; HPA3; integrin alpha 2b; integrin alpha 2b (Cd41b); integrin alpha-IIb; Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain; Integrin alpha-IIb light chain, form 1; Integrin alpha-IIb light chain, form 2; integrin subunit alpha 2b; integrin subunit alpha IIb; integrin, alpha 2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); ITGA2B; ITGAB; platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb; platelet glycoprotein IIb of IIb/II Ia complex; platelet glycoprotein IIb of IIb/IIIa complex; platelet membrane glycoprotein IIb; platelet-specific antigen BAK; PPP1R93; protein phosphatase 1, regulatory subunit 93
Gene	Itga2b
Product Type	Antibody
Gene ID (Entrez)	16399
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	eBioMWReg30 (MWReg30)

2,887

Invitrogen™ CD144 (VE-cadherin) Monoclonal Antibody (16B1), Biotin, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Biotin
Applications	Flow Cytometry,Immunocytochemistry
Form	Liquid
Gene Accession No.	P33151
Isotype	IgG1
Concentration	0.5 mg/mL
Antigen	CD144 (VE-cadherin)
Gene Symbols	CDH5
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	7B4; 7B4 antigen; 7B4/cadherin-5; AA408225; cadherin 5; cadherin 5, type 2 (vascular endothelium); cadherin 5, type 2, VE-cadherin (vascular endothelium); cadherin 5, type 2, VE-cadherin (vascular epithelium); cadherin-5; cadherin-5; cd144 antigen; VE cadherin; Cd144; cd144 antigen; CDH5; cell-cell adhesion protein; endothelial-specific cadherin; vascular endothelial cadherin; vascular endothelial cadherin precursor; Vec; VEcad; VE-Cad; VE-cadherin; VECD
Gene	CDH5
Product Type	Antibody
Gene ID (Entrez)	1003
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	16B1

2,888

CD11c Monoclonal Antibody (118/A5), eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin)
Form	Liquid
Isotype	IgG2b κ
Gene Accession No.	P20702
Concentration	0.5 mg/mL
Antigen	CD11c
Gene Symbols	Itgax
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI449405; CD11 antigen-like family member C; CD11c; CD11C (p150) alpha polypeptide; complement component 3 receptor 4 subunit; complement receptor 4; Cr4; integrin alpha X; integrin alpha-X; integrin aX; integrin subunit alpha X; integrin, alpha X; integrin, alpha X (antigen CD11C (p150), alpha polypeptide); integrin, alpha X (complement component 3 receptor 4 subunit); Itgax; Leu M5; leu M5, alpha subunit; leukocyte adhesion glycoprotein p150,95 alpha chain; Leukocyte adhesion receptor p150,95; leukocyte surface antigen p150,95, alpha subunit; myeloid membrane antigen, alpha subunit; N418; p150 95 integrin alpha chain; RGD1561123; SLEB6
Gene	Itgax
Product Type	Antibody
Gene ID (Entrez)	3687
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	118/A5

2,889

Invitrogen™ BrdU Monoclonal Antibody (ZBU30)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Chemical
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry
Form	Liquid
Isotype	IgG1 κ
Concentration	1 mg/mL
Antigen	BrdU
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	5-Bromo-2-deoxyuridine; Bromodeoxyuridine
Product Type	Antibody
Formulation	PBS with 0.1% sodium azide; pH 7.4
Immunogen	BrdU.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	ZBU30

2,890

Invitrogen™ hnRNP UL1 Monoclonal Antibody (EAP 4A11), eBioscience™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Human
Host Species	Rat
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q9BUJ2
Isotype	IgG2b κ
Concentration	0.5 mg/mL
Antigen	hnRNP UL1
Gene Symbols	Hnrnpul1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Adenovirus early region 1B-associated protein 5; E130317O14Rik; E1B 55kDa associated protein 5; E1B-55 kDa-associated protein 5; E1BAP5; E1B-AP5; EIB-55kDa associated protein 5; heterogeneous nuclear ribonucleoprotein U like 1; heterogeneous nuclear ribonucleoprotein U-like 1; heterogeneous nuclear ribonucleoprotein U-like protein 1; Hnrnpul; Hnrnpul1; HNRPUL1; LOW QUALITY PROTEIN: heterogeneous nuclear ribonucleoprotein U-like protein 1
Gene	Hnrnpul1
Product Type	Antibody
Gene ID (Entrez)	11100
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	EAP 4A11

2,891

Invitrogen™ FAP Monoclonal Antibody (F11-24), eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry,Immunoprecipitation
Form	Liquid
Gene Accession No.	Q12884
Isotype	IgG1
Concentration	1 mg/mL
Antigen	FAP
Gene Symbols	FAP
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	170 kDa melanoma membrane-bound gelatinase; Antiplasmin-cleaving enzyme FAP, soluble form; APCE; Dipeptidyl peptidase FAP; DPPIV; Fap; FAPA; FAPalpha; fibroblast activation protein; fibroblast activation protein alpha; fibroblast activation protein, alpha; gelatine degradation protease FAP; Integral membrane serine protease; post-proline cleaving enzyme; Prolyl endopeptidase FAP; seprase; Serine integral membrane protease; SIMP; Surface-expressed protease
Gene	FAP
Product Type	Antibody
Gene ID (Entrez)	2191
Formulation	PBS with no preservative
Immunogen	Rec. Human FAP.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	F11-24

2,892

Invitrogen™ ABCA4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Lyophilized
Gene Accession No.	O35600, P78363
Isotype	IgG
Concentration	500 μg/mL
Antigen	ABCA4
Gene Symbols	ABCA4
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	ABC transporter; ABC10; abca4; abca4.L; Abcr; ARMD2; ATP binding cassette subfamily A member 4; ATP binding cassette subfamily A member 4 L homeolog; ATP binding cassette transporter; ATP-binding cassette 10; ATP-binding cassette sub-family A member 4; ATP-binding cassette transporter, retinal-specific; ATP-binding cassette, subfamily A (ABC1), member 4; ATP-binding cassette, sub-family A (ABC1), member 4; ATP-binding cassette, sub-family A, member 4; ATP-binding transporter, retina-specific; AW050280; CORD3; D430003I15Rik; FFM; photoreceptor rim protein; retinal ABCA4 transporter; retinal-specific ATP-binding cassette transporter; Retinal-specific phospholipid-transporting ATPase ABCA4; retina-specific ABC transporter; RIM ABC transporter; RIM protein; RMP; RP19; Stargardt disease protein; STGD; STGD1; XELAEV_180233141mg
Gene	ABCA4
Product Type	Antibody
Gene ID (Entrez)	11304, 24, 310836
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human ABCA4 (1890-1927aa FLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQR).
Classification	Polyclonal
Primary or Secondary	Primary

2,893

Invitrogen™ CD41 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P08514, Q9QUM0
Isotype	IgG
Concentration	500 μg/mL
Antigen	CD41
Gene Symbols	Itga2b
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI172977; alpha IIb; alphaIIb; alphaIIb protein; BDPLT16; BDPLT2; CD41; CD41B; form 1; form 2; GP IIb; GP2B; GPalpha IIb; GPIIb; GT; GTA; HPA3; integrin alpha 2b; integrin alpha 2b (Cd41b); integrin alpha-IIb; Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain; Integrin alpha-IIb light chain, form 1; Integrin alpha-IIb light chain, form 2; integrin subunit alpha 2b; integrin subunit alpha IIb; integrin, alpha 2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); ITGA2B; ITGAB; platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb; platelet glycoprotein IIb of IIb/II Ia complex; platelet glycoprotein IIb of IIb/IIIa complex; platelet membrane glycoprotein IIb; platelet-specific antigen BAK; PPP1R93; protein phosphatase 1, regulatory subunit 93
Gene	Itga2b
Product Type	Antibody
Gene ID (Entrez)	16399, 3674, 685269
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN).
Classification	Polyclonal
Primary or Secondary	Primary

2,894

Invitrogen™ CD28 Monoclonal Antibody (5B8), APC, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Canine
Host Species	Mouse
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	0
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	CD28
Gene Symbols	Cd28
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	antigen CD28; CD28; CD28 antigen; CD28 antigen (Tp44); CD28 isoform; CD28 isoform 2; Cd28 molecule; CD28 precursor protein; CD28 protein; CD28 protein precursor; CD28RNA; cell surface protein; CHT28; contains partial extracellular domain; costimulatory molecule B7 receptor CD28; EGK_04709; MGC138290; sCD28; soluble CD28; T44; T-cell costimulatory molecule CD28; T-cell costimulatory molecule Tp44; T-cell-specific surface glycoprotein CD28; T-cell-specific surface glycoprotein CD28 homolog; TP44
Gene	Cd28
Product Type	Antibody
Gene ID (Entrez)	403646
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	5B8

2,895

Invitrogen™ VWF Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	Q62935, Q8CIZ8
Isotype	IgG
Concentration	500 μg/mL
Antigen	VWF
Gene Symbols	VWF
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	6820430P06Rik; AI551257; B130011O06Rik; C630030D09; Coagulation Factor VIII; coagulation factor VIII VWF; EMBL:CAB37852.1}; F8VWF; factor viii related antigen; von Willebrand antigen 2; von Willebrand antigen II; von Willebrand Disease (vWD); von Willebrand factor; Von Willebrand factor homolog; VWD; vwf; vwf {ECO:0000312
Gene	VWF
Product Type	Antibody
Gene ID (Entrez)	116669, 22371
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	E.coli-derived mouse VWF recombinant protein (Position: M1304-E1452).
Classification	Polyclonal
Primary or Secondary	Primary

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ TRPM2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SOX10 Recombinant Rabbit Monoclonal Antibody (PDH0-04) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD304 (Neuropilin-1) Monoclonal Antibody (3DS304M), PE, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD206 (MMR) Monoclonal Antibody (19.2), PerCP-eFluor™ 710, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD41a Monoclonal Antibody (eBioMWReg30 (MWReg30)), APC-eFluor™ 780, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD144 (VE-cadherin) Monoclonal Antibody (16B1), Biotin, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ BrdU Monoclonal Antibody (ZBU30) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ hnRNP UL1 Monoclonal Antibody (EAP 4A11), eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ FAP Monoclonal Antibody (F11-24), eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ABCA4 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD41 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD28 Monoclonal Antibody (5B8), APC, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ VWF Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TRPM2 Polyclonal Antibody

Invitrogen™ SOX10 Recombinant Rabbit Monoclonal Antibody (PDH0-04)

Invitrogen™ CD304 (Neuropilin-1) Monoclonal Antibody (3DS304M), PE, eBioscience™

CD206 (MMR) Monoclonal Antibody (19.2), PerCP-eFluor™ 710, eBioscience™, Invitrogen™

Invitrogen™ CD41a Monoclonal Antibody (eBioMWReg30 (MWReg30)), APC-eFluor™ 780, eBioscience™

Invitrogen™ CD144 (VE-cadherin) Monoclonal Antibody (16B1), Biotin, eBioscience™

Invitrogen™ BrdU Monoclonal Antibody (ZBU30)

Invitrogen™ hnRNP UL1 Monoclonal Antibody (EAP 4A11), eBioscience™

Invitrogen™ FAP Monoclonal Antibody (F11-24), eBioscience™

Invitrogen™ ABCA4 Polyclonal Antibody

Invitrogen™ CD41 Polyclonal Antibody

Invitrogen™ CD28 Monoclonal Antibody (5B8), APC, eBioscience™

Invitrogen™ VWF Polyclonal Antibody